Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.4e-05
atypical teratoid / rhabdoid tumor 5112 3.0e-05
ovarian cancer 8520 4.5e-04
medulloblastoma, large-cell 6241 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Secretory diarrhea 10 4.279 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 3.0e-05
medulloblastoma, large-cell -1.100 1.1e-02
osteosarcoma 1.326 2.4e-05
ovarian cancer -1.600 4.5e-04

Gene RIF (1)

AA Sequence

MKQLKRKRKSNFSVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVK      1 - 70
RRYLDWRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRNDANFDWQNVADFRDAGGSLTE     71 - 140
VKVEEEERDPQSPEFEIEEEEEMLSSVIPDSRRENELPDFPHIDEFFTLNSTPSRSAYDEPHLLVNIEKQ    141 - 210
KLELEKRRLDIEAERLQVEKERLQIEKERLRHLDMEHERLQLEKERLQIEREKLRLQIVNSEKPSLENEL    211 - 280
GQGEKSMLQPQDIETEKLKLERERLQLEKDRLQFLKFESEKLQIEKERLQVEKDRLRIQKEGHLQ         281 - 345
//

Text Mined References (15)

PMID Year Title