Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.98
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.9e-06
glioblastoma 1.100 4.5e-07
group 3 medulloblastoma 1.100 5.3e-05
osteosarcoma -1.461 3.7e-03
pediatric high grade glioma 1.100 3.8e-06
primitive neuroectodermal tumor 1.300 1.5e-04
subependymal giant cell astrocytoma 1.037 2.1e-02
ulcerative colitis 1.200 4.5e-05

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MQNNEIIKPAKYFSELEKSILLALVEKYKYVLECKKSDARTIALKQRTWQALAHEYNSQPSVSLRDFKQL      1 - 70
KKCWENIKARTKKIMAHERREKVKRSVSPLLSTHVLGKEKIASMLPEQLYFLQSPPEEEPEYHPDASAQE     71 - 140
SFAVSNRELCDDEKEFIHFPVCEGTSQPEPSCSAVRITANKNYRSKTSQEGALKKMHEEEHHQQMSILQL    141 - 210
QLIQMNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP         211 - 275
//

Text Mined References (14)

PMID Year Title