Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.500 4.8e-04
astrocytic glioma -1.400 6.2e-03
Astrocytoma, Pilocytic -1.200 6.1e-05
atypical teratoid / rhabdoid tumor -1.400 8.3e-06
ependymoma -1.300 1.4e-02
glioblastoma -1.100 6.9e-07
group 4 medulloblastoma -1.300 1.3e-03
medulloblastoma, large-cell -1.700 1.2e-03
oligodendroglioma -1.400 6.6e-03

 Compartment GO Term (1)

AA Sequence

MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKR      1 - 70
NAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCD     71 - 140
GKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKV    141 - 210
QSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREVRRVLDQQHILQVQSLQLQERMMSLLERIITKSSV      211 - 278
//

Text Mined References (4)

PMID Year Title