Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.85
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAP      1 - 70
YPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMV     71 - 140
ALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQL    141 - 210
YSNNPGSSFSSTQSQDHIQQVKKSSSRSWI                                            211 - 240
//

Text Mined References (11)

PMID Year Title