Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.86
PubTator Score 14.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
osteosarcoma 7933 8.3e-11
Waldenstrons macroglobulinemia 764 3.4e-03
sarcoidosis 368 1.3e-02
acute myeloid leukemia 785 2.9e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 3.993 3.4e-03
osteosarcoma -7.749 8.3e-11
sarcoidosis 1.100 1.3e-02
acute myeloid leukemia -3.400 2.9e-02

Synonym

Accession Q96HJ5 A8MTP8 Q8NHW2
Symbols HTM4
CD20L

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
25886616 Our data reveal MS4A3 as a novel direct target of EVI1 in human myeloid cells, and show that its repression plays a role in EVI1 mediated tumor aggressiveness.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19818099 High HTm4 is associated with neoplasms.
15830103 The C-terminal domain is important for the function of HTm4 in cell cycle regulation.
15671017 HTm4 binding to KAP.Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2

AA Sequence

MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLG      1 - 70
SLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLS     71 - 140
LNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSP    141 - 210
PNSV                                                                      211 - 214
//

Text Mined References (17)

PMID Year Title
25886616 2015 EVI1 promotes tumor growth via transcriptional repression of MS4A3.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19818099 2011 Characterization of the expression of HTm4 (MS4A3), a cell cycle regulator, in human peripheral blood cells and normal and malignant tissues.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15830103 2005 [Regulatory role of HTm4 gene in hematopoietic cell cycle].
15671017 2005 Binding of HTm4 to cyclin-dependent kinase (Cdk)-associated phosphatase (KAP).Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11781350 2002 Human HTm4 is a hematopoietic cell cycle regulator.
11486273 2001 Structural organization of the human MS4A gene cluster on Chromosome 11q12.
11401424 2001 Identification of a CD20-, FcepsilonRIbeta-, and HTm4-related gene family: sixteen new MS4A family members expressed in human and mouse.
7524084 1994 Cloning of the cDNA for a hematopoietic cell-specific protein related to CD20 and the beta subunit of the high-affinity IgE receptor: evidence for a family of proteins with four membrane-spanning regions.