Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.55
PubTator Score 14.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.5e-11
Waldenstrons macroglobulinemia 765 3.4e-03
sarcoidosis 370 1.3e-02
acute myeloid leukemia 783 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -3.400 2.9e-02
osteosarcoma -5.838 6.5e-11
sarcoidosis 1.100 1.3e-02
Waldenstrons macroglobulinemia 3.993 3.4e-03

Gene RIF (8)

AA Sequence

MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLG      1 - 70
SLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLS     71 - 140
LNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSP    141 - 210
PNSV                                                                      211 - 214
//

Text Mined References (18)

PMID Year Title