Property Summary

NCBI Gene PubMed Count 103
PubMed Score 1135.09
PubTator Score 79.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.900 1.6e-03
invasive ductal carcinoma 1.089 6.9e-04
lung adenocarcinoma -1.500 1.2e-07
lung cancer -1.200 1.3e-03
lung carcinoma -1.100 2.8e-03
non-small cell lung cancer -2.035 1.3e-23
osteosarcoma -2.876 1.1e-07
uncontrolled asthma 1.200 6.7e-04

Gene RIF (82)

AA Sequence

MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAM      1 - 70
ICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIA     71 - 140
GGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKG    141 - 210
NKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL                                        211 - 244
//

Text Mined References (103)

PMID Year Title