Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.91
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
colon cancer 1.600 4.9e-04
group 3 medulloblastoma 1.200 3.8e-02
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02
lung cancer 1.300 3.2e-04
non diabetic and post-ischemic heart fai... -1.200 8.5e-03
non-small cell lung cancer 1.032 3.1e-15
oligodendroglioma -1.200 4.1e-02
osteosarcoma 1.325 3.5e-03
ovarian cancer 1.500 6.3e-06

Gene RIF (3)

AA Sequence

MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKN      1 - 70
KVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPG     71 - 140
PLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDS    141 - 210
QSGRFQQMGDDLPESASESTEESDSEDDD                                             211 - 239
//

Text Mined References (16)

PMID Year Title