Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.53
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.830 2.3e-04
pancreatic ductal adenocarcinoma liver m... -2.224 2.3e-02
acute myeloid leukemia -1.300 2.2e-02
ovarian cancer 2.100 8.1e-06

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with mitochondrial ribosomal protein S9 (MRPS9) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPCVSYGGAVSYRLLLWGRGSLARKQGLWKTAAPELQTNVRSQILRLRHTAFVIPKKNVPTSKRETYT      1 - 70
EDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQW     71 - 140
GEDGRPFHYLFYTGKQSYYSLMHDVYGMLLNLEKHQSHLQAKSLLPEKTVTRDVIGSRWLIKEELEEMLV    141 - 210
EKLSDLDYMQFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQLIEPVQYDEQGMAFSKSEGKRKTAK    211 - 280
AEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAK    281 - 350
ALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGARRKFTWKKR                            351 - 396
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300802 2004 ZNF143 activates gene expression in response to DNA damage and binds to cisplatin-modified DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11344316 2001 Identification of four proteins from the small subunit of the mammalian mitochondrial ribosome using a proteomics approach.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.