Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.21
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Coronary artery disease 268 0.0 0.0

Expression

Gene RIF (5)

AA Sequence

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYA      1 - 70
PTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK                    71 - 125
//

Text Mined References (21)

PMID Year Title