Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.82
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease 1.500 9.8e-03
ependymoma -1.100 4.9e-02
osteosarcoma 1.589 6.4e-04
intraductal papillary-mucinous adenoma (... 1.600 1.1e-03
intraductal papillary-mucinous carcinoma... 1.500 8.8e-03
ovarian cancer 1.500 8.1e-07

Gene RIF (1)

PMID Text
19559069 Data demonstrated that while ribosomal proteins S16 and S5 is able to bind to the 18S rRNA independently, their simultaneous binding has a noticeable synergetic effect.

AA Sequence

MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPYASLSRALQTQ      1 - 70
CCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFL     71 - 140
WPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGP    141 - 210
CGETYEDFDTRILEVRNVFTMTAKEGRKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLH    211 - 280
YIERYEDHTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLF    281 - 350
RGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRS    351 - 420
VWSNLKRAAT                                                                421 - 430
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19559069 2009 Interactions of human ribosomal proteins S16 and S5 with an 18S rRNA fragment containing their binding sites.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11402041 2001 Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28 S small subunit.
11344316 2001 Identification of four proteins from the small subunit of the mammalian mitochondrial ribosome using a proteomics approach.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.