Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.59
PubTator Score 2.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Avian influenza 7 3.522 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 3.2e-03
lung cancer 1.200 1.1e-03
osteosarcoma -1.383 1.8e-04
ovarian cancer -1.600 2.5e-06
pancreatic ductal adenocarcinoma liver m... -1.003 3.0e-02
psoriasis -1.100 3.5e-03

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAASIVRRGMLLARQVVLPQLSPAGKRYLLSSAYVDSHKWEAREKEHYCLADLASLMDKTFERKLPVSSL      1 - 70
TISRLIDNISSREEIDHAEYYLYKFRHSPNCWYLRNWTIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPD     71 - 140
NFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPSTQLLSLYVLFHCLAKKTDFSWEEERNFGASLLL    141 - 210
PGLKQKNSVGFSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREAL    211 - 280
DVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESE    281 - 350
GLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA          351 - 414
//

Text Mined References (20)

PMID Year Title