Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.24
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MLRALSRLGAGTPCRPRAPLVLPARGRKTRHDPLAKSKIERVNMPPAVDPAEFFVLMERYQHYRQTVRAL      1 - 70
RMEFVSEVQRKVHEARAGVLAERKALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQA     71 - 140
RKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS         141 - 205
//

Text Mined References (16)

PMID Year Title