Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.100 8.0e-03
ependymoma 1.100 4.3e-02
oligodendroglioma 1.100 3.3e-02
osteosarcoma -4.026 2.2e-10
atypical teratoid / rhabdoid tumor -1.800 1.0e-05
glioblastoma -2.100 1.0e-05
medulloblastoma -1.300 9.3e-03
medulloblastoma, large-cell -1.600 1.8e-05
intraductal papillary-mucinous adenoma (... 1.200 3.0e-03
intraductal papillary-mucinous carcinoma... 1.600 6.8e-04
intraductal papillary-mucinous neoplasm ... 1.700 5.1e-03
Breast cancer 2.400 2.8e-02
pediatric high grade glioma -1.400 1.6e-04
Pick disease -1.700 1.0e-05
progressive supranuclear palsy -1.500 9.6e-03
ovarian cancer -1.200 9.0e-04

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM      1 - 70
TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI     71 - 140
CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD                                         141 - 173
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
10938081 2000 A proteomics approach to the identification of mammalian mitochondrial small subunit ribosomal proteins.