Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.42
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.400 3.9e-02
acute quadriplegic myopathy 1.207 1.6e-05
adult high grade glioma -1.200 3.9e-05
astrocytic glioma -1.500 3.8e-02
Astrocytoma, Pilocytic -1.100 4.4e-06
atypical teratoid / rhabdoid tumor -1.500 9.3e-06
Breast cancer 2.600 2.7e-02
ependymoma -2.100 5.4e-03
glioblastoma -1.300 8.9e-04
group 3 medulloblastoma 1.200 1.1e-02
invasive ductal carcinoma 1.600 1.1e-02
medulloblastoma, large-cell -1.100 2.4e-03
oligodendroglioma -2.000 3.7e-03
ovarian cancer 2.100 2.1e-04

Gene RIF (2)

AA Sequence

MAGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRVRYGKAKAPIQDIWYHEDRI      1 - 70
RAKFYSVYGSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEKLFVETGKALLAEGVILRRVGEART     71 - 140
QHGGSHVSRKSEHLSVRPQTALEENETQKEVPQDQHLEAPADQSKGLLPP                        141 - 190
//

Text Mined References (20)

PMID Year Title