Property Summary

NCBI Gene PubMed Count 17
PubMed Score 211.89
PubTator Score 24.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.119 3.1e-03
ovarian cancer 1.900 6.0e-05
pancreatic ductal adenocarcinoma liver m... -1.136 2.7e-02

Gene RIF (3)

AA Sequence

MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTF      1 - 70
MDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPIND     71 - 140
VLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIF    141 - 210
KEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKK    211 - 280
IDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQ    281 - 350
EALSRHSAAS                                                                351 - 360
//

Text Mined References (23)

PMID Year Title