1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. ribosomal protein
  6. 28S ribosomal protein S2, mitochondrial

Tdark 28S ribosomal protein S2, mitochondrial

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.52
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Brain glioma 10 3.831 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.052 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.180 3.0e-02
ovarian cancer 1.800 1.8e-05

Synonym

Accession Q9Y399 Q5T899 Q9BSQ4 MRP-S2
Symbols S2mt
CGI-91
MRP-S2

Gene

MRPS2

PANTHER Protein Class (3)

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (7)

 GO Function (1)

 GO Component (2)

 GO Process (2)

 Compartment GO Term (32)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (7)

Protein-protein Interaction (69)

MRPS12   MRPS14   MRPL33   DAP3   MRPS22   MRPS25   MRPS10   MRPS35   MRPS5   MRPS36   MRPS11   MRPS15   MRPS21   MRPS34   MRPS6   MRPS9   MRPL23   MRPL51   MRPL2   MRPL54   MRPL14   MRPL21   MRPL55   MRPL10   MRPL52   MRPL41   MRPL50   MRPL43   GADD45GIP1   MRPL30   MRPS27   MRPS31   MRPL24   CHCHD1   MRPL38   MRRF   MRPS24   MRPL53   PTCD3   MRPL48   MRPL57   MRPL45   MRPL20   MRPL4   MRPL1   MRPS26   MRPL37   MRPL18   MTIF3   MRPL46   MRPL44   MRPL47   MRPS30   MRPL17   AURKAIP1   MRPL22   MRPL16   MRPL35   MRPL15   MTRF1L   MRPS33   MRPS28   MRPS17   MRPS7   MRPS16   MRPL42   MRPS23   TPD52   TPD52L2  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence 

MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHS      1 - 70
DFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKG     71 - 140
IILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVR    141 - 210
DAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPG    211 - 280
DQGPAHPPGADMSHSL                                                          281 - 296
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11402041 2001 Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28 S small subunit.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.