Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.700 7.0e-06
psoriasis -1.600 5.5e-04
osteosarcoma -2.680 1.9e-09
pancreatic ductal adenocarcinoma liver m... -1.640 6.1e-03
lung cancer 1.900 2.1e-03
acute myeloid leukemia -1.700 2.9e-02

Synonym

Accession Q9Y3D5 MRP-S18-c
Symbols CGI-134
S18mt-c
MRPS18-1
mrps18-c
MRP-S18-1
MRP-S18-c

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGK      1 - 70
HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRY     71 - 140
RE                                                                        141 - 142
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.