Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.700 2.9e-02
lung cancer 1.900 2.1e-03
malignant mesothelioma -1.700 7.0e-06
osteosarcoma -2.680 1.9e-09
pancreatic ductal adenocarcinoma liver m... -1.640 6.1e-03
psoriasis -1.600 5.5e-04

Gene RIF (3)

AA Sequence

MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGK      1 - 70
HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRY     71 - 140
RE                                                                        141 - 142
//

Text Mined References (15)

PMID Year Title