Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.10
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.200 1.7e-03
lung cancer 1.300 1.0e-03
malignant mesothelioma 1.100 1.9e-06
ovarian cancer 1.200 1.1e-02
psoriasis -1.200 1.1e-03

Gene RIF (6)

AA Sequence

MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGS      1 - 70
RPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYT     71 - 140
GVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPE    141 - 210
RELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL                          211 - 258
//

Text Mined References (25)

PMID Year Title