Property Summary

NCBI Gene PubMed Count 13
PubMed Score 323.10
PubTator Score 86.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 1.0e-04
ovarian cancer 8491 1.4e-04
osteosarcoma 7933 1.9e-04
group 3 medulloblastoma 2254 3.3e-03
Multiple myeloma 1327 5.8e-03
invasive ductal carcinoma 2950 2.9e-02
Disease Target Count Z-score Confidence
Gastroenteritis 46 5.951 3.0
Diarrhea 155 5.109 2.6

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.054 5.8e-03
osteosarcoma -1.682 1.9e-04
lung cancer 1.500 1.0e-04
group 3 medulloblastoma 1.100 3.3e-03
invasive ductal carcinoma 1.100 2.9e-02
ovarian cancer 1.500 1.4e-04

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20186120 ICT1 may be essential for hydrolysis of prematurely terminated peptidyl-tRNA moieties in stalled mitoribosomes.

AA Sequence

MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADS      1 - 70
DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESS     71 - 140
RYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD        141 - 206
//

Text Mined References (17)

PMID Year Title
27029019 2016 Human Cells Require Non-stop Ribosome Rescue Activity in Mitochondria.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
24352605 2013 Codon-reading specificities of mitochondrial release factors and translation termination at non-standard stop codons.
23908630 2013 Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome.
22821833 2012 Solution structure and siRNA-mediated knockdown analysis of the mitochondrial disease-related protein C12orf65.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20869366 2010 Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality.
20598281 2010 Mutations in C12orf65 in patients with encephalomyopathy and a mitochondrial translation defect.
20186120 2010 A functional peptidyl-tRNA hydrolase, ICT1, has been recruited into the human mitochondrial ribosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8575443 1995 Identification of mRNAs that show modulated expression during colon carcinoma cell differentiation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7545548 1995 A novel T-cell differentiation antigen expressed in immature human thymocytes and neuroglial cells.