Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.20
PubTator Score 0.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.300 6.3e-14
non primary Sjogren syndrome sicca 1.100 4.9e-02
ovarian cancer 1.600 5.9e-04

Gene RIF (1)

AA Sequence

MAALGTVLFTGVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAER      1 - 70
ETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ                      71 - 123
//

Text Mined References (13)

PMID Year Title