Property Summary

NCBI Gene PubMed Count 10
PubMed Score 555.08
PubTator Score 19.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.7e-02
ovarian cancer 1.300 2.8e-04

Gene RIF (1)

AA Sequence

MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDPPKHEHYPTPS      1 - 70
GWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQV     71 - 140
NEVTGTLRIKGYFDQELKAWLLEKGF                                                141 - 166
//

Text Mined References (13)

PMID Year Title