Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.54
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 4.0e-02
psoriasis -3.300 1.7e-05
osteosarcoma -4.134 1.0e-10
pancreatic ductal adenocarcinoma liver m... -1.502 4.2e-02
sonic hedgehog group medulloblastoma 1.200 1.0e-03

Gene RIF (4)

PMID Text
25590838 MRPL44 expression may be a representative marker of metabolic phenotype according to OxPhos amount and a useful predictor of lymph node metastasis in Papillary thyroid carcinoma.
23315540 Decreased MRPL44 affected assembly of the large ribosomal subunit and stability of 16S rRNA leading to complex IV deficiency.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of mitochondrial ribosomal protein L44 (MRPL44) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHA      1 - 70
EIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQF     71 - 140
LEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPER    141 - 210
TALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKL    211 - 280
IAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS                      281 - 332
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25590838 2015 A metabolic phenotype based on mitochondrial ribosomal protein expression as a predictor of lymph node metastasis in papillary thyroid carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23315540 2013 Whole-exome sequencing identifies a mutation in the mitochondrial ribosome protein MRPL44 to underlie mitochondrial infantile cardiomyopathy.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551941 2001 The large subunit of the mammalian mitochondrial ribosome. Analysis of the complement of ribosomal proteins present.