Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.40
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 5.7e-04
Breast cancer -2.000 4.5e-02
ependymoma 1.100 4.9e-08
gastric cancer 1.300 4.3e-04
glioblastoma 1.300 9.1e-08
group 3 medulloblastoma 1.900 1.0e-04
invasive ductal carcinoma 1.500 2.9e-04
lung cancer 2.200 1.9e-03
lung carcinoma 1.100 3.1e-11
medulloblastoma, large-cell 1.500 3.1e-05
non-small cell lung cancer 1.301 1.2e-20
osteosarcoma 1.252 3.0e-02
pediatric high grade glioma 1.300 1.3e-06
primitive neuroectodermal tumor 1.400 2.1e-04
psoriasis 1.200 2.4e-08

Gene RIF (4)

AA Sequence

MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYE      1 - 70
HTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPK     71 - 140
DR                                                                        141 - 142
//

Text Mined References (23)

PMID Year Title