Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.06
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.100 2.3e-02
lung cancer 1.100 2.4e-03
medulloblastoma, large-cell -1.300 8.4e-05
pancreatic ductal adenocarcinoma liver m... -1.793 3.6e-03

Gene RIF (3)

AA Sequence

MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLR      1 - 70
GFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGS     71 - 140
IRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLELPTGDPQYLTELAHYR    141 - 210
RWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPAVGLNVHSMLKHQTLVLTLPTVAFLEDKLLWQDSRY    211 - 280
RPLYPFSLPYSDFPRPLPHATQGPAATPYHC                                           281 - 311
//

Text Mined References (21)

PMID Year Title