Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.81
PubTator Score 3.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.9e-04
pancreatic ductal adenocarcinoma liver metastasis 1962 6.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.500 6.9e-04
pancreatic ductal adenocarcinoma liver m... -1.289 6.4e-03

Synonym

Accession Q9NYK5 C9JYA5 Q32Q74 Q5QTR3 Q96Q65 Q9BSQ7 Q9BZV6 Q9NX44 L39mt
Symbols L39mt
MRPL5
RPML5
MRP-L5
PRED22
PRED66
MSTP003
C21orf92

Gene

PANTHER Protein Class (1)

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MEALAMGSRALRLWLVAPGGGIKWRFIATSSASQLSPTELTEMRNDLFNKEKARQLSLTPRTEKIEVKHV      1 - 70
GKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDCDPGEVNK     71 - 140
AYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDVVLDSKLDEWMPTKENLRSFTKDAHALI    141 - 210
YKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEV    211 - 280
SAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKATEECTST                281 - 338
//

Text Mined References (17)

PMID Year Title