Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.00
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.3e-04
pancreatic ductal adenocarcinoma liver metastasis 1962 1.8e-02
Disease Target Count Z-score Confidence
Thrombophilia 38 3.042 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.400 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.701 1.8e-02

Gene RIF (2)

AA Sequence

MALASGPARRALAGSGQLGLGGFGAPRRGAYEWGVRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWL      1 - 70
ARPIFPPWDRGYKDPRFYRSPPLHEHPLYKDQACYIFHHRCRLLEGVKQALWLTKTKLIEGLPEKVLSLV     71 - 140
DDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFS    141 - 210
ATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVKNDTGFQ    211 - 280
EGYPYPYPHTLYLLDKANLRPHRLQPDQLRAKMILFAFGSALAQARLLYGNDAKVLEQPVVVQSVGTDGR    281 - 350
VFHFLVFQLNTTDLDCNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLH    351 - 420
GAA                                                                       421 - 423
//

Text Mined References (18)

PMID Year Title