Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.73
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 3.0e-15
ovarian cancer 8520 1.6e-02
Disease Target Count Z-score Confidence
Cervical cancer 24 3.344 1.7
Genital herpes 10 3.174 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.098 3.0e-15
ovarian cancer 1.300 1.6e-02

Synonym

Accession Q9P0J6 A4UCS0 B2R4Z2 Q3SWV6 Q9UKL7 L36mt
Symbols RPMJ
BRIP1
L36mt
PRPL36
MRP-L36

Gene

PDB

3J9M   3J7Y   5OOL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MANLFIRKMVNPLLYLSRHTVKPRALSTFLFGSIRGAAPVAVEPGAAVRSLLSPGLLPHLLPALGFKNKT      1 - 70
VLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM                                          71 - 103
//

Text Mined References (13)

PMID Year Title