Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.73
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 3.0e-15
ovarian cancer 8520 1.6e-02
Disease Target Count Z-score Confidence
Cervical cancer 24 3.344 1.7
Genital herpes 10 3.174 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.098 3.0e-15
ovarian cancer 1.300 1.6e-02

Gene RIF (2)

AA Sequence

MANLFIRKMVNPLLYLSRHTVKPRALSTFLFGSIRGAAPVAVEPGAAVRSLLSPGLLPHLLPALGFKNKT      1 - 70
VLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM                                          71 - 103
//

Text Mined References (13)

PMID Year Title