Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.100 1.1e-03
Multiple myeloma 1.211 1.1e-02
non primary Sjogren syndrome sicca 1.100 3.9e-02
ovarian cancer 1.600 2.8e-06
pancreatic ductal adenocarcinoma liver m... -2.035 3.1e-03

Gene RIF (1)

AA Sequence

MAVLAGSLLGPTSRSAALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRL      1 - 70
STPAGVQVILRRMLKGRKSLSH                                                     71 - 92
//

Text Mined References (12)

PMID Year Title