Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.7e-04
psoriasis 6694 2.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 1.7e-04
psoriasis 1.100 2.3e-04

Gene RIF (2)

AA Sequence

MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDA      1 - 70
GKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEA     71 - 140
GERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKY    141 - 210
KKVYWY                                                                    211 - 216
//

Text Mined References (14)

PMID Year Title