Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.21
PubTator Score 8.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.562 8.9e-03
aldosterone-producing adenoma -1.541 6.9e-03
Breast cancer 2.000 3.7e-02
dermatomyositis 1.100 1.4e-03
lung cancer 2.600 1.1e-03
nasopharyngeal carcinoma 1.100 1.8e-03
non-small cell lung cancer 1.053 1.1e-16
osteosarcoma -1.053 3.3e-03
ovarian cancer 2.000 3.0e-03
psoriasis 1.400 1.3e-02

Gene RIF (7)

AA Sequence

MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVE      1 - 70
PERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQR     71 - 140
SGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQE    141 - 210
PNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEA    211 - 280
AIWKEIEASKRS                                                              281 - 292
//

Text Mined References (22)

PMID Year Title