Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.123 2.4e-03
astrocytic glioma -1.100 1.5e-02
glioblastoma 1.100 1.3e-03
colon cancer 1.300 5.9e-03
lung cancer 1.400 1.1e-04
non primary Sjogren syndrome sicca 1.600 1.5e-02
ovarian cancer 2.200 2.0e-06

Synonym

Accession Q9NRX2 D3DQU3 Q6IAH8 Q96Q53 Q9C066 L17mt
Symbols LIP2
L17mt
RPL17L
RPML26
MRP-L17
MRP-L26

Gene

PDB

3J9M   3J7Y   2CQM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
22082156 Knockdown of mitochondrial ribosomal protein L17 (MRPL17) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20877624 Observational study of gene-disease association. (HuGE Navigator)
18162190 High levels of LIP2 were found in serum and synovial fluid of rheumatoid arthritis patients, providing evidence for a cytokine-like role.

AA Sequence

MRLSVAAAISHGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNE      1 - 70
RAMRMADFWLTEKDLIPKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDS     71 - 140
HLTLLNQLLQGLRQDLRQSQEASNHSSHTAQTPGI                                       141 - 175
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18162190 2008 High levels of the proNGF peptides LIP1 and LIP2 in the serum and synovial fluid of rheumatoid arthritis patients: evidence for two new cytokines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10593885 1999 Mammalian mitochondrial ribosomal proteins (2). Amino acid sequencing, characterization, and identification of corresponding gene sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.