Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 1.5e-02
colon cancer 1.300 5.9e-03
glioblastoma 1.100 1.3e-03
lung cancer 1.400 1.1e-04
Multiple myeloma 1.123 2.4e-03
non primary Sjogren syndrome sicca 1.600 1.5e-02
ovarian cancer 2.200 2.0e-06

Gene RIF (3)

AA Sequence

MRLSVAAAISHGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNE      1 - 70
RAMRMADFWLTEKDLIPKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDS     71 - 140
HLTLLNQLLQGLRQDLRQSQEASNHSSHTAQTPGI                                       141 - 175
//

Text Mined References (16)

PMID Year Title