Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.98
PubTator Score 21.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 1.200 6.7e-07
breast carcinoma 1.500 1.1e-26
ductal carcinoma in situ 1.100 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.700 7.5e-04
invasive ductal carcinoma 1.400 2.9e-03
lung adenocarcinoma 1.117 8.9e-05
lung cancer 1.800 1.5e-03
non-small cell lung cancer 1.080 1.5e-16
ovarian cancer 1.900 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.114 2.8e-02

Gene RIF (3)

AA Sequence

MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGN      1 - 70
KWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKN     71 - 140
LVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL                                    141 - 178
//

Text Mined References (21)

PMID Year Title