Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.10
PubTator Score 21.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.114 2.8e-02
non-small cell lung cancer 1.080 1.5e-16
intraductal papillary-mucinous neoplasm ... 1.700 7.5e-04
lung cancer 2.200 7.8e-05
lung adenocarcinoma 1.117 8.9e-05
breast carcinoma 1.500 1.1e-26
Breast cancer 1.700 7.8e-09
ductal carcinoma in situ 1.100 3.3e-02
invasive ductal carcinoma 1.400 2.9e-03
ovarian cancer 1.900 1.9e-03

Synonym

Accession Q9BYD1 B2R4R8 Q9UI04 L13mt
Symbols L13
L13A
L13mt
RPL13
RPML13

Gene

PDB

3J9M   3J7Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18995835 DAPK-ZIPK-L13a axis forms a unique regulatory module that first represses, then repermits inflammatory gene expression.

AA Sequence

MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGN      1 - 70
KWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKN     71 - 140
LVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL                                    141 - 178
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25317112 2014 Epidemiological and genome-wide association study of gastritis or gastric ulcer in korean populations.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21531335 2011 MTERF4 regulates translation by targeting the methyltransferase NSUN4 to the mammalian mitochondrial ribosome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20601428 2010 Properties of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L and its interactions with mammalian mitochondrial ribosomes.
18995835 2008 DAPK-ZIPK-L13a axis constitutes a negative-feedback module regulating inflammatory gene expression.
15560738 Alterations in mitochondrial and apoptosis-regulating gene expression in photodynamic therapy-resistant variants of HT29 colon carcinoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11279069 2001 Structural compensation for the deficit of rRNA with proteins in the mammalian mitochondrial ribosome. Systematic analysis of protein components of the large ribosomal subunit from mammalian mitochondria.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.