Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.09
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4971 4.6e-10
osteosarcoma 7766 9.4e-07
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Alzheimer's disease 640 0.0 1.4

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 4.6e-10
osteosarcoma -1.841 9.4e-07

Gene RIF (1)

AA Sequence

MSSKHRICSQEEVVIPCAYDSDSESVDLELSNLEIIKKGSSSIELTDLDIPDIPGLHCEPLSHSPRHLTQ      1 - 70
QDPLSEAIVEKLIQSIQKVFNGELKGELEKLKFLGDLSSLSQALPYDETAKSFIHSHIADIVHTLNVLVQ     71 - 140
EERPHSLSSSMRQEVFVTIADLSYQDVHLLLGSEDRAELFSLTIKSIITLPSVRTLTQIQEIMPNGTCNT    141 - 210
ECLYRQTFQAFSEMLQSLVVKDPHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSL    211 - 280
LHITLRLKYITHDKKDQQNLKRALTKCREFLELHSSAAKCFYNCPFRIAQVFEGFLDSNELCQFIMTTFD    281 - 350
TLKTLKHPCIQRSAGELLLTLAKNTESQFEKVPEIMGVICAQLSIISQPRVRQQIINTVSLFISRPKYTD    351 - 420
IVLSFLLCHPVPYNRHLAEVWRMLSVELPSTTWILWRLLRKLQKCHNEPAQEKMAYVAVAVSP           421 - 483
//

Text Mined References (12)

PMID Year Title