Property Summary

NCBI Gene PubMed Count 8
PubMed Score 139.66
PubTator Score 14.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 3.3e-02
atypical teratoid / rhabdoid tumor -4.100 1.9e-10
ependymoma -1.500 8.9e-05
glioblastoma -1.900 1.1e-03
group 3 medulloblastoma -1.500 2.7e-04
medulloblastoma, large-cell -4.500 5.9e-08
mucosa-associated lymphoid tissue lympho... 1.718 3.2e-02
osteosarcoma -1.677 3.2e-03
ovarian cancer 1.300 1.4e-10
pancreatic ductal adenocarcinoma liver m... -1.456 2.3e-03
primitive neuroectodermal tumor -3.400 3.8e-05
subependymal giant cell astrocytoma -2.077 3.6e-02

Synonym

Accession Q9BYG7 B7Z2I5 B7Z3B2 E9PAT5 E9PBI3 K7EKJ8 Q8N6K5
Symbols B29
C18orf3

Gene

MRO

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDPSAKKRHMAMR      1 - 70
NLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGKIQGKGLGSFFIDITLQTRTL     71 - 140
LDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKL    141 - 210
KEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL                                    211 - 248
//

Text Mined References (9)

PMID Year Title