Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.71
PubTator Score 5.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.3e-05
Multiple myeloma 1332 3.2e-05
group 3 medulloblastoma 4104 2.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.4e-03
Multiple myeloma 1.030 3.2e-05
ovarian cancer 2.300 1.3e-05

Gene RIF (6)

AA Sequence

MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQIL      1 - 70
RPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRIL     71 - 140
EVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTE    141 - 210
EFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ                                      211 - 246
//

Text Mined References (14)

PMID Year Title