Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma 2.200 1.8e-03
medulloblastoma, large-cell 3.200 3.4e-02
subependymal giant cell astrocytoma -3.273 8.8e-03

Gene RIF (1)

PMID Text
25640239 The human and mouse MLN genes consist of three exons that span 16.5 and 15.0 kb, respectively, with the ORF located in exon 3; findings identify MLN as an important regulator of skeletal muscle physiology.

AA Sequence

MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS                              1 - 46
//

Text Mined References (3)

PMID Year Title
25640239 2015 A micropeptide encoded by a putative long noncoding RNA regulates muscle performance.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.