Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.30
PubTator Score 5.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 3.1e-06
esophageal adenocarcinoma 1.100 2.9e-02
psoriasis -1.200 4.5e-04
osteosarcoma -1.130 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-03
lung cancer 1.800 3.7e-04
Breast cancer 1.900 4.2e-02
ovarian cancer 1.100 1.5e-05

Gene RIF (4)

PMID Text
21602893 role in tumorogenesis of cutaneous squamous cell carcinoma
21535316 MRGBP contributes to colorectal carcinogenesis through rendering advantages in cell proliferation and/or division of cancer cells.
20051959 These results suggest that C20orf20 protein has an important function in proliferation of cancer cells through the regulation of BRD8 protein.
12963728 MRGBP is encoded by the FLJ10914 ORF and is a new component of the TRRAP/TIP60 HAT complex

AA Sequence

MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGR      1 - 70
QVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGA     71 - 140
DDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT          141 - 204
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21602893 2011 Integrative mRNA profiling comparing cultured primary cells with clinical samples reveals PLK1 and C20orf20 as therapeutic targets in cutaneous squamous cell carcinoma.
21535316 2011 MRG-binding protein contributes to colorectal cancer development.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20051959 2010 C20orf20 (MRG-binding protein) as a potential therapeutic target for colorectal cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.