Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.70
PubTator Score 9.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.1e-09
ovarian cancer 8520 2.9e-04
Disease Target Count Z-score Confidence
Cervix uteri carcinoma in situ 16 3.407 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.300 1.1e-09
ovarian cancer -1.500 2.9e-04

Gene RIF (2)

AA Sequence

MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ      1 - 70
VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS                  71 - 127
//

Text Mined References (19)

PMID Year Title