Property Summary

NCBI Gene PubMed Count 9
PubMed Score 78.45
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.100 1.3e-04
malignant mesothelioma -3.900 2.4e-07
ependymoma -1.800 1.4e-02
oligodendroglioma -1.100 3.5e-02
psoriasis 1.800 3.0e-14
glioblastoma 2.000 5.1e-03
osteosarcoma 1.610 3.2e-04
intraductal papillary-mucinous adenoma (... 1.900 4.1e-03
intraductal papillary-mucinous carcinoma... 1.800 1.0e-02
intraductal papillary-mucinous neoplasm ... 2.400 1.0e-02
lung cancer 1.200 4.7e-02
pancreatic cancer 1.200 7.3e-06
fibroadenoma 1.100 7.2e-03
Breast cancer 2.900 3.3e-02
pediatric high grade glioma 1.400 1.6e-02
group 4 medulloblastoma -1.200 3.6e-02
subependymal giant cell astrocytoma -1.079 3.8e-02
spina bifida -1.782 3.6e-02
ductal carcinoma in situ 1.700 2.7e-03
invasive ductal carcinoma 1.500 1.0e-02
ovarian cancer 1.700 1.1e-04
pituitary cancer -1.400 5.8e-03

Gene RIF (2)

PMID Text
25301234 MREG-dependent processing links both autophagic and phagocytic processes in LC3-associated phagocytosis. MREG participates in coordinating the association of phagosomes with LC3 for content degradation with the MREG loss leading to phagosome accumulation.
20463177 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTL      1 - 70
YNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTR     71 - 140
KAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLP    141 - 210
FPSP                                                                      211 - 214
//

Text Mined References (13)

PMID Year Title
25301234 2015 The Contribution of Melanoregulin to Microtubule-Associated Protein 1 Light Chain 3 (LC3) Associated Phagocytosis in Retinal Pigment Epithelium.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22275436 2012 Melanoregulin regulates retrograde melanosome transport through interaction with the RILP-p150Glued complex in melanocytes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20463177 2010 Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene.
19240024 2009 Melanoregulin (MREG) modulates lysosome function in pigment epithelial cells.
17260955 2007 The tetraspanin protein peripherin-2 forms a complex with melanoregulin, a putative membrane fusion regulator.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15550542 2004 dsu functions in a MYO5A-independent pathway to suppress the coat color of dilute mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.