Property Summary

NCBI Gene PubMed Count 35
PubMed Score 77.42
PubTator Score 58.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
26527274 A model of the ligand-binding region of uPARAP was obtained by molecular replacement.
26466547 Our findings identify sarcoma cell-resident uPARAP/Endo180 as a central player in the bone degeneration of advanced osteosarcoma
26284904 The positive correlation between suPLAUR expression and body mass index, suggests that leukocyte recruitment in obese tissue may be regulated, at least in part, through the splicing of the PLAUR transcript.
25408555 AGE-dependent modification of the basal lamina induces invasive behaviour in non-transformed prostate epithelial cells via Endo180 pathway linked to cancer progression.
25381222 Study identifies the interaction between lectin domain in Endo180 and CD147 as an Epithelial-to-mesenchymal transition suppressor and indicates that stabilization of this molecular complex improves prostate cancer survival rates.
24161566 MRC2 is downregulated by UVA irradiation and reduces collagen internalization; this can be recovered by all-trans retinoic acid
23433549 Our findings correlate for the first time impaired collagen uptake via Endo180 with the pericellular accumulation of collagen fragments during photoaging.
23148569 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
22132194 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
22072289 TGFbeta1-Endo180-dependent collagen deposition is dysregulated at the tumour-stromal interface in bone metastasis.
21768090 A novel functional role of collagen glycosylation: interaction with the endocytic collagen receptor uparap/ENDO180.
20845060 Our present study suggests that uPARAP may be involved in glioma cell invasiveness through actin cytoskeletal rearrangement
20339555 fibrillar collagen deposition and the collagen internalization receptor endo180 have roles in glioma invasion
19861500 Endo180 is a novel regulator of membrane-bound matrix metalloproteinase (MT1-MMP) activity, MT1-MMP-dependent MMP-2 activation and urokinase plasminogen activator (uPA) activity.
19584075 Observational study of gene-disease association. (HuGE Navigator)
19224860 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
17974964 To investigate the consequence of Endo180 up-regulation, MCF7 cells transfected with Endo180 were inoculated into immunocompromised mice; expression of wild-type Endo180, but not an internalization-defective Endo180 mutant, showed enhanced tumor growth.
17360361 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
17189524 Data suggest that uPARAP/Endo180 participates in the connective tissue destruction during head and neck squamous cell carcinoma progression by mediating cellular uptake and lysosomal degradation of collagen.
16615932 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
16547227 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
15955449 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
15047828 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells
12972549 Endo180 plays a physiological role in mediating collagen matrix remodelling during tissue development and homeostasis
12952933 Results suggest that Endo180 is a crucial link between urokinase-type plasminogen activator and its receptor and setting of the internal cellular compass.
12668656 By using cell isolates from uPARAP deficient mice, it is demonstrated that uPARAP is a collagen receptor. Thus uPARAP deficient fibroblasts can not internalize collagen and show a reduced adhesion/migration on collagen surfaces
12645947 Approximately 60% of the initial association of HIV with macrophages that lack expression of DC-SIGN (a dendritic cell-specific ICAM-3 receptor/HIV-1-binding protein) is mediated by the macrophage mannose receptor.
12399458 characterization of the monosaccharide binding sites
12244146 Mannose receptor activity is up-regulated by surfactant protein A on monocyte-derived macrophages.
12068012 Endo180 was found to be distinct within the mannose receptor family in that the tyrosine-based motif is not required for efficient delivery to and recycling from early endosomes
11903048 Investigation of the role of Endo180/urokinase-type plasminogen activator receptor-associated protein as a collagenase 3 (matrix metalloproteinase 13) receptor
11120831 HIV-1 gp120 binds to mannose receptor on vaginal epithelial cells

AA Sequence

MGPGRPAPAPWPRHLLRCVLLLGCLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGGQVRVTPACNT      1 - 70
SLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGARTSN     71 - 140
ISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGH    141 - 210
LWCATTQDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIH    211 - 280
EQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRD    281 - 350
CSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI    351 - 420
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGR    421 - 490
WNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTIT    491 - 560
NRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLW    561 - 630
EVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQA    631 - 700
QGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYH    701 - 770
NFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF    771 - 840
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINF    841 - 910
ISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFL    911 - 980
NKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQ    981 - 1050
EPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPA   1051 - 1120
ALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGE   1121 - 1190
EGSRRYSWVSEEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGS   1191 - 1260
CPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWL   1261 - 1330
GMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWRPGACTNITMGVVCKLPRAEQ   1331 - 1400
SSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQSIERGAFEGARYSRSSSSPTEATEKNILVS   1401 - 1470
DMEMNEQQE                                                                1471 - 1479
//

Text Mined References (41)

PMID Year Title
26527274 2015 Expression and crystallographic studies of the ligand-binding region of the human endocytic collagen receptor uPARAP.
26466547 2016 Targeting a novel bone degradation pathway in primary bone cancer by inactivation of the collagen receptor uPARAP/Endo180.
26284904 2015 The mRNA expression of soluble urokinase plasminogen activator surface receptor in human adipose tissue is positively correlated with body mass index.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25408555 2015 AGE-modified basement membrane cooperates with Endo180 to promote epithelial cell invasiveness and decrease prostate cancer survival.
25381222 2015 Survival Outcome and EMT Suppression Mediated by a Lectin Domain Interaction of Endo180 and CD147.
24161566 2014 Reduced collagen internalization via down-regulation of MRC2 expression by UVA irradiation and its recovery by all-trans retinoic acid.
23433549 2013 UV-mediated downregulation of the endocytic collagen receptor, Endo180, contributes to accumulation of extracellular collagen fragments in photoaged skin.
22072289 2012 TGF?1-Endo180-dependent collagen deposition is dysregulated at the tumour-stromal interface in bone metastasis.
21768090 2011 A novel functional role of collagen glycosylation: interaction with the endocytic collagen receptor uparap/ENDO180.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20845060 2011 Downregulation of uPARAP mediates cytoskeletal rearrangements and decreases invasion and migration properties in glioma cells.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20339555 2010 A role for fibrillar collagen deposition and the collagen internalization receptor endo180 in glioma invasion.
19861500 2009 Membrane type-1 matrix metalloproteinase activity is regulated by the endocytic collagen receptor Endo180.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
17974964 2007 The collagen receptor Endo180 (CD280) Is expressed on basal-like breast tumor cells and promotes tumor growth in vivo.
17189524 2007 Increased expression of the collagen internalization receptor uPARAP/Endo180 in the stroma of head and neck cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12972549 2003 Identification and characterization of the endocytic transmembrane glycoprotein Endo180 as a novel collagen receptor.
12952933 2003 GPI-anchored uPAR requires Endo180 for rapid directional sensing during chemotaxis.
12668656 2003 uPARAP/Endo180 is essential for cellular uptake of collagen and promotes fibroblast collagen adhesion.
12645947 2003 Involvement of macrophage mannose receptor in the binding and transmission of HIV by macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399458 2002 Characterization of sugar binding by the mannose receptor family member, Endo180.
12244146 2002 Pulmonary surfactant protein A up-regulates activity of the mannose receptor, a pattern recognition receptor expressed on human macrophages.
12068012 2002 The C-type lectin receptor Endo180 displays internalization and recycling properties distinct from other members of the mannose receptor family.
11903048 2002 Investigation of the role of Endo180/urokinase-type plasminogen activator receptor-associated protein as a collagenase 3 (matrix metalloproteinase 13) receptor.
11120831 2000 HIV-1 Tat represses transcription from the mannose receptor promoter.
10683150 2000 Endo180, an endocytic recycling glycoprotein related to the macrophage mannose receptor is expressed on fibroblasts, endothelial cells and macrophages and functions as a lectin receptor.
10636902 2000 A urokinase receptor-associated protein with specific collagen binding properties.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9192860 1997 Cloning of human chromosome 17-specific cDNAs using representational difference analysis and human-mouse hybrid cells.
8702911 1996 Characterization of a novel member of the macrophage mannose receptor type C lectin family.
7904248 1993 A novel, specific pro-urokinase complex on monocyte-like cells, detected by transglutaminase-catalyzed cross-linking.