Property Summary

NCBI Gene PubMed Count 29
PubMed Score 278.17
PubTator Score 22.53

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
25973078 The association of the MARS rs6782181 polymorphism and serum lipid levels is different between the Mulao and Han populations, or between males and females in the both ethnic groups.
25800439 The MRAS gene loci might have a minor effect in conferring susceptibility to coronary artery disease in the Chinese population.
24211266 Both MRAS and SHOC2 play a key role in polarized migration.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198612 Identification of one new CAD risk locus on 3q22.3 in MRAS, and suggestive association with a locus on 12q24.31 near HNF1A-C12orf43.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17538012 These findings proved a crucial role of the cross-talk between two Ras-family GTPases M-Ras and Rap1, mediated by RA-GEF-2, in adhesion signaling.
12138204 implicated in a novel pathway of neuronal differentiation by coupling specific trophic factors to the MAPK cascade through the activation of B-Raf

AA Sequence

MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG      1 - 70
QEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQ     71 - 140
GKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL      141 - 208
//

Text Mined References (30)

PMID Year Title
25973078 2015 Association between the MARS rs6782181 polymorphism and serum lipid levels.
25800439 2015 Genetic insight into the role of MRAS in coronary artery disease risk.
25137548 2014 A Novel SHOC2 Variant in Rasopathy.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24211266 2013 An MRAS, SHOC2, and SCRIB complex coordinates ERK pathway activation with polarity and tumorigenic growth.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19198612 2009 New susceptibility locus for coronary artery disease on chromosome 3q22.3.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
17538012 2007 The M-Ras-RA-GEF-2-Rap1 pathway mediates tumor necrosis factor-alpha dependent regulation of integrin activation in splenocytes.
17143285 2007 Germline gain-of-function mutations in SOS1 cause Noonan syndrome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16630891 2006 A phosphatase holoenzyme comprised of Shoc2/Sur8 and the catalytic subunit of PP1 functions as an M-Ras effector to modulate Raf activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138204 2002 R-Ras3/M-Ras induces neuronal differentiation of PC12 cells through cell-type-specific activation of the mitogen-activated protein kinase cascade.
11524421 2001 Identification and characterization of RA-GEF-2, a Rap guanine nucleotide exchange factor that serves as a downstream target of M-Ras.
10934204 2000 Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction.
10803462 2000 R-Ras3, a brain-specific Ras-related protein, activates Akt and promotes cell survival in PC12 cells.
10498616 1999 M-Ras, a widely expressed 29-kD homologue of p21 Ras: expression of a constitutively active mutant results in factor-independent growth of an interleukin-3-dependent cell line.
10477695 1999 Interleukin-9-induced expression of M-Ras/R-Ras3 oncogene in T-helper clones.
10446149 1999 M-Ras/R-Ras3, a transforming ras protein regulated by Sos1, GRF1, and p120 Ras GTPase-activating protein, interacts with the putative Ras effector AF6.
9400994 1997 Identification and characterization of R-ras3: a novel member of the RAS gene family with a non-ubiquitous pattern of tissue distribution.