Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.24
PubTator Score 23.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis -1.200 7.3e-03
hepatocellular carcinoma 1.100 7.2e-04
esophageal adenocarcinoma -1.900 2.9e-02
psoriasis 2.600 1.7e-12
cutaneous lupus erythematosus 2.200 2.4e-03
osteosarcoma -1.194 8.7e-05
Atopic dermatitis 1.500 7.2e-04
intraductal papillary-mucinous adenoma (... 2.000 3.9e-03
intraductal papillary-mucinous neoplasm ... 2.400 7.4e-03
pancreatic cancer 1.500 7.0e-06
fibroadenoma 1.200 3.9e-02
interstitial cystitis -1.900 1.7e-04
lung adenocarcinoma 1.325 4.4e-03
Endometriosis -1.331 2.0e-02
lung carcinoma -2.900 7.2e-23
spina bifida -1.561 3.0e-02
Breast cancer -2.000 3.5e-08
ductal carcinoma in situ 1.600 8.2e-03
ovarian cancer 2.900 3.5e-06
pituitary cancer -1.800 3.5e-06

Gene RIF (3)

PMID Text
26930581 CLCA2 links junctional adhesion molecule EVA1, to cytosolic signaling proteins that modulate proliferation and differentiation.
26677976 Findings highlight Eva1 as a novel regulator of GIC function and also provide new mechanistic insight into the role of noncanonical NF-kappaB activation in GIC.
21440040 EVA is expressed in human choroid plexus epithelial cells and CD4 T lymphocytes and regulates CD4+ T lymphocyte adhesion to human choroid plexus epithelial cells in vitro. These data suggest a novel mechanism to regulate CNS immune surveillance.

AA Sequence

MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDG      1 - 70
GPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRL     71 - 140
SVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVY    141 - 210
LEDTD                                                                     211 - 215
//

Text Mined References (12)

PMID Year Title
26930581 2016 CLCA2 Interactor EVA1 Is Required for Mammary Epithelial Cell Differentiation.
26677976 2016 Eva1 Maintains the Stem-like Character of Glioblastoma-Initiating Cells by Activating the Noncanonical NF-?B Signaling Pathway.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21440040 2011 Characterization of epithelial V-like antigen in human choroid plexus epithelial cells: potential role in CNS immune surveillance.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9585423 1998 Epithelial V-like antigen (EVA), a novel member of the immunoglobulin superfamily, expressed in embryonic epithelia with a potential role as homotypic adhesion molecule in thymus histogenesis.