Property Summary

NCBI Gene PubMed Count 26
PubMed Score 20.99
PubTator Score 11.14

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

Gene RIF (10)

PMID Text
24296779 MPZL1 is a target gene within the 1q24.1-24.2 amplicon that plays a pivotal role in HCC cell migration and tumor metastasis, and a novel MPZL1/Src/cortactin signaling cascade.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19629567 Clinico-electrophysiological features and MRI findings are described in leg musculature from three patients belonging to a CMT2J pedigree due to MPZ Thr124Met mutation.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
18568953 Phosphorylation and localization of PZR in cultured endothelial cells is reported.
16702974 Observational study of gene-disease association. (HuGE Navigator)
16702974 the MPZL1/PZR gene may be important in the predisposition to schizophrenia among Han Chinese
12684038 Characterization of PZR1b, an alternative spliced isoform of PZR.
11751924 PZR is a major receptor of ConA and has an important role in cell signaling via c-Src. Considering the various biological activities of ConA, the study of PZR may have major therapeutic implications

AA Sequence

MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLT      1 - 70
SVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNP     71 - 140
PDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLS    141 - 210
PVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN               211 - 269
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24296779 2014 Amplification of MPZL1/PZR promotes tumor cell migration through Src-mediated phosphorylation of cortactin in hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22881374 2012 Genome-wide association and linkage study in the Amish detects a novel candidate late-onset Alzheimer disease gene.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19629567 2009 Charcot–Marie–Tooth disease type 2J with MPZ Thr124Met mutation: clinico-electrophysiological and MRI study of a family.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18568953 Phosphorylation and localization of protein-zero related (PZR) in cultured endothelial cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16702974 2006 MPZL1/PZR, a novel candidate predisposing schizophrenia in Han Chinese.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12684038 2003 Identification of a variant form of PZR lacking immunoreceptor tyrosine-based inhibitory motifs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12410637 2003 Novel mesenchymal and haematopoietic cell isoforms of the SHP-2 docking receptor, PZR: identification, molecular cloning and effects on cell migration.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
12075424 2000 Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics Strategy.
11751924 2002 Cell surface glycoprotein PZR is a major mediator of concanavalin A-induced cell signaling.
10681522 2000 Dissecting the interaction of SHP-2 with PZR, an immunoglobulin family protein containing immunoreceptor tyrosine-based inhibitory motifs.
9792637 1998 Purification and cloning of PZR, a binding protein and putative physiological substrate of tyrosine phosphatase SHP-2.