Property Summary

NCBI Gene PubMed Count 24
PubMed Score 13.16
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.102 5.2e-04
psoriasis -2.100 1.9e-04
osteosarcoma 1.413 1.2e-02
atypical teratoid / rhabdoid tumor -2.300 3.4e-08
glioblastoma -1.900 3.9e-04
medulloblastoma, large-cell -2.100 4.4e-04
primitive neuroectodermal tumor -1.100 1.1e-02
pancreatic ductal adenocarcinoma liver m... 1.144 7.2e-03
adult high grade glioma -1.900 1.6e-03
spina bifida -1.446 3.6e-02
ovarian cancer 1.500 4.0e-04

Gene RIF (6)

PMID Text
24901049 The B-Raf(V600E) inhibitor dabrafenib selectively inhibits RIP3 and alleviates acetaminophen-induced liver injury.
22349701 Our data identify M-RIP as a crucial local regulator of the Rho-Rac balance during chemotaxis and antigen recognition.
21242312 MLCP (myosin light chain phosphatase) activation is counteracted by a previously unrecognized association between MRIP and the inducible kinase NUAK2
18636174 A functional analysis of JNK1 and M-RIP with RNA interference reveals a critical role for this cascade in the invasive behavior of cancer cells.
16257966 M-RIP-dependent targeting of myosin phosphatase to stress fibers has an important role in regulating myosin light chain phosphorylation state and morphology in human vascular smooth muscle cells
15545284 p116Rip is an important regulatory component that controls the RhoA signaling pathway, thus regulating MLCP activity and myosin phosphorylation in cells

AA Sequence

MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQAKPIYGGWLLLAPDGTDFDNPVHRSRKWQ      1 - 70
RRFFILYEHGLLRYALDEMPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIVSG     71 - 140
WLEMLMVYPRTNKQNQKKKRKVEPPTPQEPGPAKVAVTSSSSSSSSSSSIPSAEKVPTTKSTLWQEEMRT    141 - 210
KDQPDGSSLSPAQSPSQSQPPAASSLREPGLESKEEESAMSSDRMDCGRKVRVESGYFSLEKTKQDLKAE    211 - 280
EQQLPPPLSPPSPSTPNHRRSQVIEKFEALDIEKAEHMETNAVGPSPSSDTRQGRSEKRAFPRKRDFTNE    281 - 350
APPAPLPDASASPLSPHRRAKSLDRRSTEPSVTPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRD    351 - 420
SVAEEAADLDGEIDLSACYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTTAPDV    421 - 490
TSSLPEEKNKSSCSFETCPRPTEKQEAELGEPDPEQKRSRARERRREGRSKTFDWAEFRPIQQALAQERV    491 - 560
GGVGPADTHEPLRPEAEPGELERERARRREERRKRFGMLDATDGPGTEDAALRMEVDRSPGLPMSDLKTH    561 - 630
NVHVEIEQRWHQVETTPLREEKQVPIAPVHLSSEDGGDRLSTHELTSLLEKELEQSQKEASDLLEQNRLL    631 - 700
QDQLRVALGREQSAREGYVLQATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATIS    701 - 770
AIEAMKNAHREEMERELEKSQRSQISSVNSDVEALRRQYLEELQSVQRELEVLSEQYSQKCLENAHLAQA    771 - 840
LEAERQALRQCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGKDAYELEVLLRVKE    841 - 910
SEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDS    911 - 980
ATVSGYDIMKSKSNPDFLKKDRSCVTRQLRNIRSKSVIEQVSWDT                             981 - 1025
//

Text Mined References (34)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24901049 2014 The B-Raf(V600E) inhibitor dabrafenib selectively inhibits RIP3 and alleviates acetaminophen-induced liver injury.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349701 2012 Association of syntenin-1 with M-RIP polarizes Rac-1 activation during chemotaxis and immune interactions.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21242312 2011 An association between NUAK2 and MRIP reveals a novel mechanism for regulation of actin stress fibers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636174 2008 M-RIP, a novel target of JNK signaling and a requirement for human cancer cell invasion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16257966 2005 M-RIP targets myosin phosphatase to stress fibers to regulate myosin light chain phosphorylation in vascular smooth muscle cells.
16243315 2005 Inhibition of RhoA-mediated SRF activation by p116Rip.
15545284 2005 p116Rip decreases myosin II phosphorylation by activating myosin light chain phosphatase and by inactivating RhoA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469989 2004 p116Rip targets myosin phosphatase to the actin cytoskeleton and is essential for RhoA/ROCK-regulated neuritogenesis.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506264 2003 Myosin phosphatase-Rho interacting protein. A new member of the myosin phosphatase complex that directly binds RhoA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.