Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 3.4e-03
ependymoma -2.700 3.3e-12
oligodendroglioma -1.800 8.2e-03
glioblastoma -3.900 1.4e-06
medulloblastoma -2.900 1.0e-04
atypical teratoid / rhabdoid tumor -3.800 5.2e-10
medulloblastoma, large-cell -3.100 4.1e-03
primitive neuroectodermal tumor -3.100 1.9e-03
pediatric high grade glioma -2.600 1.1e-04
pilocytic astrocytoma -2.700 4.0e-05

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQP      1 - 70
PHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPY     71 - 140
EYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSP    141 - 210
WQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLH    211 - 280
VFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS                            281 - 326
//

Text Mined References (9)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9266672 1997 The 239AB gene on chromosome 22: a novel member of an ancient gene family.
8666403 1995 cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region.