Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1.34
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.200 5.2e-03
astrocytic glioma -1.200 2.2e-02
Astrocytoma, Pilocytic -1.100 2.7e-04
atypical teratoid / rhabdoid tumor -2.200 5.8e-06
Breast cancer -1.200 8.3e-03
cystic fibrosis -1.529 4.0e-06
ependymoma -1.200 4.1e-02
glioblastoma -1.200 4.3e-08
group 4 medulloblastoma -1.600 8.2e-03
interstitial cystitis -1.800 1.5e-03
intraductal papillary-mucinous adenoma (... -1.800 4.0e-03
intraductal papillary-mucinous carcinoma... -1.700 3.5e-02
medulloblastoma, large-cell -2.300 5.2e-04
nasopharyngeal carcinoma -1.500 4.6e-03
oligodendroglioma -2.200 2.1e-02
osteosarcoma -2.271 1.0e-02
pancreatic cancer -1.200 5.4e-04
pituitary cancer -1.300 3.6e-03
primitive neuroectodermal tumor -2.200 5.6e-03
psoriasis 1.400 9.9e-04
Rheumatoid arthritis 1.400 3.6e-02
spina bifida -2.395 4.2e-02
subependymal giant cell astrocytoma -1.333 2.1e-02
ulcerative colitis -2.100 6.9e-06
urothelial carcinoma -1.600 3.2e-02

Gene RIF (7)

AA Sequence

MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILH      1 - 70
GAAALADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYDPVLPPMPEDIDDEEDSVKII     71 - 140
RLVKNREPLGATIKKDEQTGAIIVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIQILAQSQG    141 - 210
AITFKIIPGSKEETPSKEGKMFIKALFDYNPNEDKAIPCKEAGLSFKKGDILQIMSQDDATWWQAKHEAD    211 - 280
ANPRAGLIPSKHFQERRLALRRPEILVQPLKVSNRKSSGFRKSFRLSRKDKKTNKSMYECKKSDQYDTAD    281 - 350
VPTYEEVTPYRRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQESDGVEYIFI    351 - 420
SKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPS    421 - 490
IERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFD    491 - 560
KLETETHWVPVSWLHS                                                          561 - 576
//

Text Mined References (33)

PMID Year Title