Property Summary

NCBI Gene PubMed Count 42
PubMed Score 124.91
PubTator Score 53.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 2.2e-09
medulloblastoma -1.300 8.0e-04
atypical teratoid / rhabdoid tumor 1.500 2.2e-04
medulloblastoma, large-cell -2.400 4.5e-05
interstitial cystitis -1.100 1.3e-05
ulcerative colitis -1.200 2.6e-05
ovarian cancer -1.900 5.1e-09

Gene RIF (13)

PMID Text
25760605 Removal of this side chain enhances the binding affinity by more than fivefold, suggesting that access of Crb to Pals1 may be regulated by intradomain contacts or by protein-protein interaction.
24488012 The unique in-frame MPP5-FAM71D fusion product is important for proliferation of PC346C cells.
22337881 the crystal structure of a 4-L27 domain-containing heterotrimer derived from the tripartite complex Patj/Pals1/Mals2
22114289 Small irregularly shaped spots are detected throughout the Pals1-deficient retina of conditional knockdown mice by confocal scanning laser ophthalmoscopy and spectral domain optical coherence tomography.
22102253 Crystals of tripartite complex 1 of L27(PATJ)-(L27N,L27C)(Pals1)-L27(MALS) diffracted to 2.05 A resolution
21479189 The cell polarity protein PALS1 is expressed in T lymphocytes and participates to the optimal activation of NF-kappaB following TCR stimulation.
20861307 Data suggest that hijacking of PALS1 by SARS-CoV E plays a determinant role in the disruption of the lung epithelium in SARS patients.
20833712 Polycystin-2 activity is controlled by transcriptional coactivator with PDZ binding motif and PALS1-associated tight junction protein
20237282 Polarity protein associated with lin seven 1 (Pals1) plays an essential role in radical and longitudinal extension of the myelin sheath in peripheral nerves, likely involving membrane protein trafficking.
17920587 the importance of a conserved Crumbs-MPP5-EPB41L5 polarity complex in mammals for separation of the apical and basolateral domains through specialized cell-cell junctions
15475968 PDZ domain plasticity has a role in internal recognition in the Par-6-Pals1 complex
12771187 the Crumbs3-Pals1 complex has a role in development of polarity in mammalian epithelial cells
11927608 Pals1 functions as an adapter, linking mammalian homologues of Crumbs and Discs Lost.

AA Sequence

MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRR      1 - 70
EEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVD     71 - 140
SQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTA    141 - 210
LLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVII    211 - 280
SRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHV    281 - 350
KAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK    351 - 420
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNC    421 - 490
GQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSI    491 - 560
DSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTRE    561 - 630
MEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR                             631 - 675
//

Text Mined References (47)

PMID Year Title
25760605 2015 Structures of the human Pals1 PDZ domain with and without ligand suggest gated access of Crb to the PDZ peptide-binding groove.
25416956 2014 A proteome-scale map of the human interactome network.
24488012 2015 Next-generation sequencing reveals novel rare fusion events with functional implication in prostate cancer.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23201090 2013 miR-199a-5p regulates urothelial permeability and may play a role in bladder pain syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22337881 2012 Structure of an L27 domain heterotrimer from cell polarity complex Patj/Pals1/Mals2 reveals mutually independent L27 domain assembly mode.
22114289 2011 PALS1 is essential for retinal pigment epithelium structure and neural retina stratification.
22102253 2011 Crystallization and preliminary X-ray data collection of the L27(PATJ)-(L27N,L27C)(Pals1)-L27(MALS) tripartite complex.
21481793 2011 A tight junction-associated Merlin-angiomotin complex mediates Merlin's regulation of mitogenic signaling and tumor suppressive functions.
21479189 2011 Participation of the cell polarity protein PALS1 to T-cell receptor-mediated NF-?B activation.
20861307 2010 The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis.
20833712 2010 Polycystin-2 activity is controlled by transcriptional coactivator with PDZ binding motif and PALS1-associated tight junction protein.
20237282 2010 Pals1 is a major regulator of the epithelial-like polarization and the extension of the myelin sheath in peripheral nerves.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17920587 2007 FERM protein EPB41L5 is a novel member of the mammalian CRB-MPP5 polarity complex.
17584769 2007 MPP1 links the Usher protein network and the Crumbs protein complex in the retina.
17332497 2007 The MAGUK protein MPP7 binds to the polarity protein hDlg1 and facilitates epithelial tight junction formation.
16678097 2006 A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15914641 2005 MPP5 recruits MPP4 to the CRB1 complex in photoreceptors.
15863617 2005 A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
15558731 2005 Membrane-associated guanylate kinase proteins MPP4 and MPP5 associate with Veli3 at distinct intercellular junctions of the neurosensory retina.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475968 2004 Internal recognition through PDZ domain plasticity in the Par-6-Pals1 complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12771187 2003 The Crumbs3-Pals1 complex participates in the establishment of polarity in mammalian epithelial cells.
12545177 2003 Direct interaction of two polarity complexes implicated in epithelial tight junction assembly.
12527193 2003 Mammalian Crumbs3 is a small transmembrane protein linked to protein associated with Lin-7 (Pals1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927608 2002 The Maguk protein, Pals1, functions as an adapter, linking mammalian homologues of Crumbs and Discs Lost.
11311936 2001 VAM-1: a new member of the MAGUK family binds to human Veli-1 through a conserved domain.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10753959 2000 Molecular cloning and characterization of Pals, proteins associated with mLin-7.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.