Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.24
PubTator Score 7.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 2.325 1.3e-07
posterior fossa group B ependymoma -1.500 1.9e-13
glioblastoma -1.500 2.0e-05
sonic hedgehog group medulloblastoma -1.900 1.6e-08
atypical teratoid/rhabdoid tumor -1.700 2.1e-12
medulloblastoma, large-cell -1.100 1.4e-03
pediatric high grade glioma -1.700 1.2e-08
pilocytic astrocytoma -1.300 1.3e-09
subependymal giant cell astrocytoma -1.893 2.2e-02
lung carcinoma 1.200 1.9e-33
ovarian cancer -1.100 1.3e-04
pituitary cancer 1.400 9.0e-07

Gene RIF (2)

PMID Text
19665017 MPP2 interacts with c-Src in cells to control c-Src activity and morphological function.
18854154 Knockdown of membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2, MPP2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIMESPIVRSLAKVIMVLWFMQQNVFVPMKYML      1 - 70
KYFGAHERLEETKLEAVRDNNLELVQEILRDLAHVAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYE     71 - 140
TPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIK    141 - 210
EVNGQPVGSDPRALQELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAG    211 - 280
DLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTT    281 - 350
KNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREG    351 - 420
QGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVV    421 - 490
FIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAM    491 - 560
EKLRTEPQWVPVSWVY                                                          561 - 576
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19665017 2009 The PDZ protein MPP2 interacts with c-Src in epithelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8824795 1996 Isolation of a gene (DLG3) encoding a second member of the discs-large family on chromosome 17q12-q21.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7590743 1995 A gene (DLG2) located at 17q12-q21 encodes a new homologue of the Drosophila tumor suppressor dIg-A.