Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.62
PubTator Score 40.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (8)

PMID Text
25408337 Studies indicate that palmitoylated erythrocyte membrane protein p55 (MPP1) and its palmitoylation play a crucial role in lateral membrane organization in erythroid cells.
23507198 MPP1 knockdown significantly affects the activation of MAP-kinase signaling.
22496366 pathophysiological relationship between the loss of MPP1-directed palmitoylation activity and perturbed lateral membrane organization.
21509594 MPP1 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
19144871 p55-NF2 protein interaction may play a functional role in the regulation of apico-basal polarity and tumor suppression pathways in non-erythroid cells.
18952129 p55 binds to two distinct sites within the FERM domain, and the alternatively spliced exon 5 is necessary for the membrane targeting of protein 4.1R in epithelial cells.
17584769 MPP1 links the Usher protein network and the Crumbs protein complex in the retina
16741958 Results show the NMR-derived structure of the human erythroid p55 PDZ domain and propose a possible interaction mode with the C-terminus of glycophorin C.

AA Sequence

MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVR      1 - 70
LIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKET     71 - 140
KGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGS    141 - 210
SKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF    211 - 280
KRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLE    281 - 350
FGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE    351 - 420
AIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY                            421 - 466
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25408337 2015 Membrane rafts in the erythrocyte membrane: a novel role of MPP1p55.
23507198 2013 The role of MPP1/p55 and its palmitoylation in resting state raft organization in HEL cells.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22496366 2012 Palmitoylation of MPP1 (membrane-palmitoylated protein 1)/p55 is crucial for lateral membrane organization in erythroid cells.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19144871 2009 Identification of erythrocyte p55/MPP1 as a binding partner of NF2 tumor suppressor protein/Merlin.
18952129 2009 Alternatively spliced exon 5 of the FERM domain of protein 4.1R encodes a novel binding site for erythrocyte p55 and is critical for membrane targeting in epithelial cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17584769 2007 MPP1 links the Usher protein network and the Crumbs protein complex in the retina.
16741958 2006 Solution structure of human erythroid p55 PDZ domain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15952887 2005 Membrane-associated guanylate kinases regulate adhesion and plasticity at cell junctions.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
9305870 1997 The PDZ domain of human erythrocyte p55 mediates its binding to the cytoplasmic carboxyl terminus of glycophorin C. Analysis of the binding interface by in vitro mutagenesis.
8824805 1996 Complete genomic organization of the human erythroid p55 gene (MPP1), a membrane-associated guanylate kinase homologue.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7822301 1995 Identification of the protein 4.1 binding interface on glycophorin C and p55, a homologue of the Drosophila discs-large tumor suppressor protein.
1713685 1991 Molecular identification of a major palmitoylated erythrocyte membrane protein containing the src homology 3 motif.
1310897 1992 A major palmitoylated membrane protein of human erythrocytes shows homology to yeast guanylate kinase and to the product of a Drosophila tumor suppressor gene.
1301163 1992 The gene encoding the palmitoylated erythrocyte membrane protein, p55, originates at the CpG island 3' to the factor VIII gene.