Property Summary

NCBI Gene PubMed Count 167
PubMed Score 584.70
PubTator Score 602.96

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (162)

PMID Text
26890983 In essential thrombocythemia, MPL mutations might be associated with a higher risk of fibrotic transformation and the presence of JAK2/MPL mutations with higher risk of thrombosis.
26817954 mutant CALR promotes myeloproliferative neoplasm development by activating c-MPL and its downstream pathway.
26668133 Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants.
26627830 His(499) regulates the activation of human TpoR and provides additional protection against activating mutations, such as oncogenic Asn mutations in the TM domain
26614694 Compared to normal controls, the frequency of the JAK246/1 haplotype was significantly higher among patients with JAK2V617F, JAK2Ex12del, or MPL mutations, whereas no significant difference was found among CALR mutation-positive patients
26505790 Using C-mannosylation defective mutant of c-Mpl, the C-mannosylated tryptophan residues at four sites (Trp(269), Trp(272), Trp(474), and Trp(477)) are essential for c-Mpl-mediated JAK-STAT signaling.
26450985 this study has shown that in a fraction of the so-called triple-negative ETs a significant proportion of patients have mutations in signaling molecules, more particularly in MPL.
26314963 PARP-1 has an important role in the progression of acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene
26159733 erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage
26071474 The data supports the proposal of including MPL exon 10 mutations as major diagnostic markers for myeloproliferative neoplasms.
25970554 we describe a Mpl W515K somatic mutation in a paediatric case of ET who presented with Budd-Chiari syndrome. No paediatric patient harbouring a Mpl W515K mutation has been previously reported.
25911549 Flow cytometric detection of MPL (CD110) as a diagnostic tool for differentiation of congenital thrombocytopenias.
25761530 Letter/Meta-analysis: thrombopoietin receptor agonists significantly increase the risk of portal vein thrombosis in liver diseases.
25637689 No individuals with either the MPL W515K mutation or the JAK2 exon 12 mutations were identified
25573593 MPL gene mutations are associated with essential thrombocythaemia and major thrombotic complications.
25538044 The P106L mutation functionally separates The activity of c-Mpl in downstream signaling from that in maintaining platelet homeostasis.
25482134 CALR mutation, MPL mutation and triple negativity may have roles in lowering vascular risk in primary myelofibrosis
25468569 OTT1 regulates the alternative splicing of Mpl-TR, a truncated isoform of c-Mpl, which modulates Thrombopoietin-mediated signaling.
25398833 MPL mutation is associated with myeloproliferative neoplasms.
25343958 Amino acid substitutions in a thrombopoietin receptor (Mpl)--containing cell growth switch (CGS) extending receptor stability improve the expansion capacity of human cord blood CD34(+) cells in the absence of exogenous cytokines.
25231745 Molecular monitoring of patients having undergone AHSCT for PMF should not be restricted to JAK2, MPL or CALR, but all mutations present in primary fibrotic neoplastic myeloproliferation should be included to interpret abnormal blood values after AHSCT
25189720 Mutations in JAK2, MPL, and CALR appear to be the main driver mutations in the majority of myeloproliferative neoplasms. (Review)
25103330 The phenotype and status of the commonly acquired JAK2 V617F, CALR exon 9 and MPL W515L/K mutations in affected individuals from a consecutive series of ten familial myeloproliferative neoplasms kindred are described.
24986690 Data indicate that of the 617 subjects studied, 399 (64.7%) carried Janus kinase 2 (JAK2), 140 (22.7%) had a CALR (calreticulin gene) exon 9 indel, 25 (4.0%) carried an thrombopoietin receptor (MPL) mutation.
24931576 Both immature and mature Mpl reach the cell surface.
24402162 The current study identifies 'CALR(-)ASXL1(+)' and 'triple-negative' as high-risk molecular signatures in PMF.
24085601 The effects of inhibition of the TPO/c-MPL pathway on enhancing the chemotherapy sensitivity of AML cells.
24043765 These experiments define a novel VEGF-miR-1-Mpl-P-selectin effector pathway in lung Th2 inflammation and herald the utility of miR-1 and Mpl as potential therapeutic targets for asthma.
23986553 investigation of JAK2V617F, Exon12_JAK2 and MPLW515K/L was relevant for the diagnosis of 38.4% of patients suspected to have BCR-ABL1-negative myeloproliferative neoplasms
23908116 Impaired transcriptional regulation of the MPL signaling that normally governs megakaryopoiesis and erythropoiesis underlies congenital amegakaryocytic thrombocytopenia.
23747337 In migrating cancer stem cells isolated from primary human colorectal cancers, CD110(+) and CDCP1(+) subpopulations mediate organ-specific lung and liver metastasis.
23575445 Loss of heterozygosity of chromosome 1p involving the MPL location may represent a molecular mechanism of fibrotic transformation in MPL-mutated myeloproliferative neoplasms.
23511495 MPL Baltimore mutation is associated with thrombocytosis.
23441089 MPL W515L mutation in pediatric essential thrombocythemia.
23359689 Tryptophan at the transmembrane-cytosolic junction modulates thrombopoietin receptor dimerization and activation.
23351976 Different mutations of the human c-mpl gene indicate distinct hematopoietic diseases.
22613795 Up-regulation of wild-type MPL levels promotes leukemia development and maintenance through activation of the PI3K/AKT axis.
22565617 genetic association studies in Italian population: Data suggest that JAK2 GGCC haplotype is associated with JAK2 mutation (V617F) but is not associated with MPL mutation in exon 10 in myeloproliferative neoplasm subjects. [meta-analysis included]
22378845 Selection against TpoR antiproliferative signaling occurs by TpoR down-modulation and that restoration of down-modulated TpoR levels could become a biomarker for the treatment of myeloproliferative neoplasms.
22338178 The expression of EPOR and TPOR on CD34+ CD59+ bone marrow cells are significantly higher than those on CD34+ CD59- cells of paroxysmal nocturnal hemoglobinuria patients.
22337712 High MPL expression is associated with leukemia.
22290824 Ligand-inducible dimerization of intracellular Mpl in human myeloerythroid progenitors induces progenitor expansion and erythropoiesis.
22180433 This study shows for the first time a link between homozygous MPL mutations and familial aplastic anemia. It also highlights the important role of MPL in trilineage hematopoiesis.
22102270 Studies indicate that in most of the cases the CAMT is caused by homozygous or compound heterozygous mutations in the gene MPL.
22093990 STAT5 phosphorylation levels of EPO and TPO receptors are elevated in bone marrow cells of patients with paroxysmal nocturnal hemoglobinuria.
21892137 Subtle differences in cytokine receptor dimerization provide a new layer of signalling regulation that is relevant for disease.
21858098 Results suggest that MPL mutations within the TM region could result in conformational changes including tilt and rotation (azimuthal) angles along the membrane axis.
21841770 Thrombopoietin receptor agonist therapy in primary immune thrombocytopenia is associated with bone marrow hypercellularity and mild reticulin fibrosis but not other stromal abnormalities.
21691276 MPL mutation is not associated with primary myelofibrosis.
21674576 Of 168 pts, 149 with polycythemia vera (PV) and 19 with post-PV myelofibrosis (PV-MF), two pts (1.2%; 1 PV, 1 PV-MF) harbored MPL mutations. Data suggest PV is molecularly more complex than previously appreciated. (study from Mayo Clinic, MN, USA)
21605620 Data indicate that the precise mechanisms for the different biological effects regarding stimulation through the same receptor, Mpl, remain to be elucidated.
21570117 MPL exon 10 mutations are associated with myeloproliferative neoplasms.
21555228 BCR/ABL negative and JAK2V617F-negative myeloproliferative neoplasms patients have other mutations besides W515 mutation in MPL exon10 and mutations other than single nucleotide exchange also exist
21489838 identification and characterization of a founder mutation in MPL in the Ashkenazi Jewish (AJ) population.
21489838 A founder mutation in the MPL gene c.79+2T>A causes congenital amegakaryocytic thrombocytopenia (CAMT) in the Ashkenazi Jewish population.
21402716 Data suggest that signaling and inactive states of thrombopoietin receptor are related by receptor subunit rotations, rather than a simple monomer-dimer transition.
21326037 mutations in exons 12 to 14 of Jak2 can be used to diagnose myeloproliferative disorders
21228032 double mutations in cis of MPL exon 10 in myeloproliferative neoplasms
21225925 Mutations in the thrombopoietin receptor gene, c-mpl is associated with congenital amegakaryocytic thrombocytopenia
21174945 in megakaryoblastic cells, PKC plays the crucial role in the initiation of up-regulation of PMA-induced c-mpl promoter activity
21051030 The MPL W515L/K mutations are rare in Taiwanese patients with Ph-negative myeloproliferative neoplasms.
21051030 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20890078 The frequencies of the MPL W515L/K mutations with essential thrombocythemia/post-essential thrombocythemia myelofibrosis were 3.2%.
20890078 Observational study of gene-disease association. (HuGE Navigator)
20823136 Studies demonstrate that progression to AML is part of the natural history of MPL W515L-associated disease.
20529857 separate binding sites on the Mpl receptor for TPO and hNUDC identified
20520633 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20508616 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20485371 MPLW515L mutation is not associated with myelodysplastic syndrome.
20410924 Observational study of gene-disease association. (HuGE Navigator)
20331763 The MPL W515L mutation and JAK2 exon 12 mutations can also be found in JAK2 V617F negative myeloproliferative disorders patients.
20331763 Observational study of gene-disease association. (HuGE Navigator)
20304805 The JAK2 46/1 haplotype predisposes to MPL-mutated myeloproliferative neoplasms.
20304805 Observational study of gene-disease association. (HuGE Navigator)
20232601 Propose a gene therapeutic strategy, with c-mpl as the major genetic component, to address the morbidity and mortality resulting from cytopenias in HIV infected patients.
20166549 Protein kinase C plays the essential role in the modulation of c-mpl promoter activity of megakaryoblastic cells.
20151976 Observational study of genetic testing. (HuGE Navigator)
20113830 Distinct patterns of cytogenetic and clinical progression in chronic myeloproliferative neoplasms with or without JAK2 or MPL mutations.
20113830 Observational study of gene-disease association. (HuGE Navigator)
20113333 lack of spontaneous STAT3 and STAT5 activation and the normal response to TPO is unexpected as MPLW515L leads to constitutive receptor activation and hypersensitivity to TPO in experimental models
20113333 Observational study of gene-disease association. (HuGE Navigator)
20111067 Acquisition of a MPL mutation is not influenced by the presence of JAK2 46/1 haplotype frequency in myeloproliferative neoplasms.
19996410 Results suggest that TpoR cytosolic phosphorylated Y112 and flanking sequences could become targets for pharmacologic inhibition in MPNs.
19728022 W515-P518delinsKT are missense mutations in essential thrombocythemia
19713221 Patients with familial thrombocytosis caused by MPL serine505asparagine mutation have a high risk of thrombosis, and with aging, develop splenomegaly and bone marrow fibrosis, affecting life expectancy.
19643476 MPL gene mutations seem to be associated with thrombocytosis.
19643476 Observational study of gene-disease association. (HuGE Navigator)
19608689 A recurrent MPL-S505N mutation found in Italian families with hereditary thrombocythemia is likely caused by a founder effect.
19560457 Mpl plays an important and specific role in mediating hNUDC-induced megakaryocyte proliferation and differentiation.
19521067 No evidence of a clinico-pathological association was found between the presence of MPL W515K/L mutations & haematological indices, BM cellularity, megakaryocyte morphology & clustering, spleen size or thrombotic/haemorrhagic events
19521067 Observational study of gene-disease association. (HuGE Navigator)
19483125 The Asn505 mutation of the c-MPL gene, which causes familial essential thrombocythemia, induces autonomous homodimerization of the c-Mpl protein due to strong amino acid polarity.
19469654 Increasing trend for MPL expression is associated with early to advanced stages of myelodysplastic syndrome.
19372714 JAK2V617F or MPLW515 mutations do not seem to correlate with simple clinical parameters. ET patients with wild-type JAK2were significantly younger at diagnosis.
19372714 Observational study of gene-disease association. (HuGE Navigator)
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19341705 CD90 and CD110 are are useful positive-selection markers for the isolation of cancer stem cells in some cases of T-ALL.
19302922 This research characterizes mutations of c-Mpl that lead to thrombocytopenia in a child with congenital amegakaryocytic thrombocytopenia.
19274616 MPL W515L/K mutations are associated with chronic myeloproliferative disorders.
19261614 MPL(W515L)/JAK2 complex requires membrane localization for JAK2 phosphorylation, resulting in autonomous receptor signaling.
19196872 Mutations in MPL gene is associated with chronic myeloproliferative disease.
19194467 MPLW515L mutation is associated with acute megakaryoblastic leukemia with myelofibrosis.
19194467 Observational study of gene-disease association. (HuGE Navigator)
19175989 No MPL W515L/K expression was found in early myeloproliferative disorders.
19175989 Observational study of gene-disease association. (HuGE Navigator)
19099657 A point mutation was detected in patients with essential thrombocythemia but not polycythemia vera, idiopathic myelofibrosis, or chronic myelogenous leukemia.
19099657 Observational study of gene-disease association. (HuGE Navigator)
19097174 Expression of c-MPL was associated with CD34+ AML and M2 FAB AML subtype.
19036112 study identified the novel MPL mutation p.Pro106Leu and obtained strong support for its association with development of thrombocytosis
19029146 35 MPLW515 mutations were detected in the 869 selected patients
18754026 role of mutant alleles of JAK2 & MPL in the pathogenesis of polycythemia vera, essential thrombocythemia & primary myelofibrosis [review]
18687690 AML1 can regulate the c-mpl promoter both positively and negatively by changing the binding partner according to cell types
18669880 A sensitive detection method for MPLW515L or MPLW515K mutation in chronic myeloproliferative disorders with locked nucleic acid-modified probes and real-time polymerase chain reaction is reported.
18669880 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
18566540 JAK2 and MPL mutations in polycythemia vera, essential thrombocytosis, and primary myelofibrosis [review]
18528423 results demonstrate that only the detected MPL W515 mutations trigger spontaneous MPL activation leading to a G(1)/S transition activation
18519816 MPLW515L/K mutations do not define a distinct phenotype in ET, although some differences depend on the JAK2V617F mutational status of the counterpart.
18487512 c-Mpl cytoplasmic YRRL motifs are responsible for both Tpo-mediated internalization via interactions with AP2 and lysosomal targeting after endocytosis.
18464114 MPL W515L mutations may contribute to the primary molecular pathogenesis of Chinese patients with ET
18464114 Observational study of gene-disease association. (HuGE Navigator)
18451306 MPL mutations lacked prognostic significance with respect to thrombosis, major hemorrhage, myelofibrotic transformation or survival.
18451306 Observational study of gene-disease association. (HuGE Navigator)
18422784 a severe clinical course of congenital amegakaryocytic thrombocytopenia may be expected when mutations lead to absent Mpl expression or signalling in patients with missense mutations
18297515 review of roles of Jak2, Jak3, and MPL mutations in signal transduction and etiology of myeloid malignancies
18295514 Sp1 sites in the c-mpl promoter enhancer region and Ets elements in front of the transcription start site are critical for c-mpl gene expression.
18250227 diagnostic and prognostic value of JAK2 and MPL515 mutations in 241 SVT patients
18174381 These data demonstrate that dimerization of a single cytokine receptor can deliver a profound expansion signal in both uncommitted and lymphoid-committed human hematopoietic progenitors.
18040685 no MPL (myeloproliferative leukemia virus oncogene thrombopoietin recept) W515L/K mutations were found in any patients with refractory anemia with ringed sideroblasts associated with marked thrombocytosis (RARS-T)
17956691 Expression of c-mpl in CD34+ BMHCs and platelets of polycythemia vera patients was not obviously abnormal.
17920755 MPL gene mutations were not associated with erythrocytosis, but segregated primarily with the phenotypes of thrombocytosis, extramedullary disease, myelofibrosis, and osteosclerosis.
17709604 The MPL W515L or K mutation induces a spontaneous megakaryocyte (MK) differentiation.
17666371 Mutations in MPL is associated with congenital amegakaryocytic thrombocytopenia
17658515 hNUDC binds to cell surface-captured Mpl.Co-expression of Mpl-EGFP and hNUDC-DsRed led to the release of hNUDC-DsRed into the culture medium
17540852 Clonal myelopoiesis antedates acquisition of JAK2V617F or MPLW515L/K mutations.
17507998 MPLW515K, but not JAK2V617F, is expressed in in vitro expanded CD4+ T lymphocytes from primary myelofibrosis patients
17408465 MPL mutation in myelofibrosis characterises patients with more severe anaemic phenotype
17408398 it was concluded that the oncogenic event in idiopathic myelofibrosis associated with the MPLW515L/K mutations probably occurs in a progenitor cell common to both myeloid and lymphoid cells, such as the pluripotent haematopoietic stem cell
17379761 THPO upregulates c-mpl expression during formation of CD34+ cells.
17157161 The expression of mRNA of C-MPL in platelets is a clear band by RT-PCR methods.
17052978 expression of JAK2 stabilizes mature TpoR and thus further increases its surface expression. This JAK2 effect depends on the Box 1 region, the only JAK2 interacting site in the TpoR
16868251 Observational study of genotype prevalence. (HuGE Navigator)
16868251 MPLW515L or MPLW515K mutations are present in patients with MMM or ET at a frequency of approximately 5% and 1%, respectively, but are not observed in patients with polycythemia vera (PV) or other myeloid disorders
16834459 Activation of JAK-STAT signaling via a somatic activating mutation in the transmembrane domain of MPL (MPLW515L) is an important pathogenetic event in patients with JAK2V617F-negative MF.
16470591 analysis of MPL mutations in patients suffering from congenital amegakaryocytic thrombocytopenia
16454716 in HIV infected patients, both the serum thrombopoietin (TPO) levels and the TPO-c-Mpl complexes on the platelet surface were significantly elevated
16088917 In this study, we report the binding of hNUDC to the extracellular domain of the thrombopoietin receptor (Mpl) as detected by the yeast two-hybrid system, GST pull-down, and co-immunoprecipitation.
15951300 PRV-1 overexpression is associated with a significantly increased risk of thrombosis, whereas decreased c-Mpl expression is not
15899890 Interaction with JAK2 or Tyk2 appears to protect the receptor from proteasome degradation. Sequences encompassing Box1 and Box2 regions of the receptor cytosolic domain and an intact JAK2 or Tyk2 FERM domain are required for these effects.
15741216 a C-terminal AML1 mutation leads to a decrease in Mpl receptor expression in familial thrombocytopenia
15647951 expression of TPO receptor on platelets until 1 month after birth cause a decreased TPO clearance and keep a high level of free TPO in blood, resulting in the subsequent thrombocytosis in preterm infants.
15452260 may play a role in hematopoietic inhibition during HIV-1 infection, and control of its expression levels may aid in hematopoietic recovery and thereby reduce the incidence of cytopenias occurring in infected individuals
15307100 Observational study of gene-disease association. (HuGE Navigator)
15269348 Observational study of gene-disease association. (HuGE Navigator)
15269348 K39N represents an identified functional Mpl polymorphism and is associated with altered protein expression of Mpl and a clinical phenotype of thrombocytosis.
15210714 c-Mpl truncated isoform with an essential C-terminal peptide is required for a proteolytic process
14995067 the promoter activity of myeloproliferative leukemia virus oncogene is modulated by transcription through a PKC-dependent pathway
14764528 Asn505 is an activating mutation with respect to the intracellular signaling and survival of cells in familial essential thrombocythemia deriving from a dominant-positive activating mutation of the c-MPL gene.
12200367 The cytoplasmic domain of Mpl receptor transduces exclusive signals in embryonic and fetal hematopoietic cells.
12145691 A new mutation of MPL, Trp(508) to Ser(508) in the intracellular domain of MPL, induces factor-independent growth in Ba/F3 cells & constitutively activates 3 distinct signaling pathways, SHC-Ras-Raf-MAPK/JNK, JAK-STAT, and PI3K-Akt-Bad.
12091373 The expression pattern of c-mpl in megakaryocytes correlates with thrombotic risk in essential thrombocythemia.
12010817 expressed in megakaryocytes in essential thrombocythemia
11961237 binding to platelet thrombopoietin receptor is directly involved in human thrombopoietin plasma level regulation

AA Sequence

MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYP      1 - 70
REKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIK     71 - 140
AMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSP    141 - 210
CAQPTMPWQDGPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDL    211 - 280
PGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFS    281 - 350
RCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE    351 - 420
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETA    421 - 490
WISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPPKATVSDTC    491 - 560
EEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLS    561 - 630
YWQQP                                                                     631 - 635
//

Text Mined References (169)

PMID Year Title
26890983 2016 Calreticulin variant stratified driver mutational status and prognosis in essential thrombocythemia.
26817954 2016 Activation of the thrombopoietin receptor by mutant calreticulin in CALR-mutant myeloproliferative neoplasms.
26668133 2016 Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants.
26627830 2016 His499 Regulates Dimerization and Prevents Oncogenic Activation by Asparagine Mutations of the Human Thrombopoietin Receptor.
26614694 2016 Clinical features of Japanese polycythemia vera and essential thrombocythemia patients harboring CALR, JAK2V617F, JAK2Ex12del, and MPLW515L/K mutations.
26505790 2015 C-Mannosylation of thrombopoietin receptor (c-Mpl) regulates thrombopoietin-dependent JAK-STAT signaling.
26450985 2016 Presence of atypical thrombopoietin receptor (MPL) mutations in triple-negative essential thrombocythemia patients.
26314963 2015 Inhibition of poly(ADP-ribose) polymerase 1 protects against acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene.
26159733 2015 Robust hematopoietic progenitor cell commitment in the presence of a conflicting cue.
26071474 2015 The Prevalence of JAK2, MPL, and CALR Mutations in Chinese Patients With BCR-ABL1-Negative Myeloproliferative Neoplasms.
25970554 2015 Essential thrombocythemia with Mpl W515 K mutation in a child presenting with Budd-Chiari syndrome.
25911549 2015 Flow cytometric detection of MPL (CD110) as a diagnostic tool for differentiation of congenital thrombocytopenias.
25761530 2015 Thrombopoietin receptor agonists significantly increase the risk of portal vein thrombosis in liver diseases: Meta-analysis of RCTs.
25637689 2015 The mutation profile of JAK2, MPL and CALR in Mexican patients with Philadelphia chromosome-negative myeloproliferative neoplasms.
25573593 2015 JAK2 V617F, MPL, and CALR mutations in essential thrombocythaemia and major thrombotic complications: a single-institute retrospective analysis.
25538044 2015 The thrombopoietin receptor P106L mutation functionally separates receptor signaling activity from thrombopoietin homeostasis.
25482134 2015 CALR mutation, MPL mutation and triple negativity identify patients with the lowest vascular risk in primary myelofibrosis.
25468569 2015 Ott1 (Rbm15) regulates thrombopoietin response in hematopoietic stem cells through alternative splicing of c-Mpl.
25398833 2015 JAK2, CALR, and MPL mutation spectrum in Japanese patients with myeloproliferative neoplasms.
25343958 2015 A hyperactive Mpl-based cell growth switch drives macrophage-associated erythropoiesis through an erythroid-megakaryocytic precursor.
25231745 2015 SRSF2 and U2AF1 mutations in primary myelofibrosis are associated with JAK2 and MPL but not calreticulin mutation and may independently reoccur after allogeneic stem cell transplantation.
25189720 2014 A primer on genomic and epigenomic alterations in the myeloproliferative neoplasms.
25103330 2014 Molecular heterogeneity of familial myeloproliferative neoplasms revealed by analysis of the commonly acquired JAK2, CALR and MPL mutations.
24986690 2014 Clinical effect of driver mutations of JAK2, CALR, or MPL in primary myelofibrosis.
24931576 2014 Mpl traffics to the cell surface through conventional and unconventional routes.
24402162 2014 CALR vs JAK2 vs MPL-mutated or triple-negative myelofibrosis: clinical, cytogenetic and molecular comparisons.
24085601 2014 The TPO/c-MPL pathway in the bone marrow may protect leukemia cells from chemotherapy in AML Patients.
24043765 2013 VEGF controls lung Th2 inflammation via the miR-1-Mpl (myeloproliferative leukemia virus oncogene)-P-selectin axis.
23986553 2014 Molecular genetic tests for JAK2V617F, Exon12_JAK2 and MPLW515K/L are highly informative in the evaluation of patients suspected to have BCR-ABL1-negative myeloproliferative neoplasms.
23908116 2013 Congenital amegakaryocytic thrombocytopenia iPS cells exhibit defective MPL-mediated signaling.
23747337 2013 Isolation and phenotypic characterization of colorectal cancer stem cells with organ-specific metastatic potential.
23575445 2013 Acquired copy-neutral loss of heterozygosity of chromosome 1p as a molecular event associated with marrow fibrosis in MPL-mutated myeloproliferative neoplasms.
23511495 2013 MPL Baltimore mutation and thrombocytosis: case report and literature review.
23441089 2013 MPL W515L mutation in pediatric essential thrombocythemia.
23359689 2013 Tryptophan at the transmembrane-cytosolic junction modulates thrombopoietin receptor dimerization and activation.
23351976 2013 Different mutations of the human c-mpl gene indicate distinct haematopoietic diseases.
22613795 2012 Thrombopoietin/MPL participates in initiating and maintaining RUNX1-ETO acute myeloid leukemia via PI3K/AKT signaling.
22565617 2012 JAK2 GGCC haplotype in MPL mutated myeloproliferative neoplasms.
22378845 2012 Thrombopoietin receptor down-modulation by JAK2 V617F: restoration of receptor levels by inhibitors of pathologic JAK2 signaling and of proteasomes.
22338178 2011 [EPOR and TPOR expressions on CD34+ CD59- and CD34+ CD59+ bone marrow cells from patients with paroxysmal nocturnal hemoglobinuria].
22337712 2012 The thrombopoietin/MPL/Bcl-xL pathway is essential for survival and self-renewal in human preleukemia induced by AML1-ETO.
22290824 2012 Novel pathways to erythropoiesis induced by dimerization of intracellular C-Mpl in human hematopoietic progenitors.
22180433 2012 Exome sequencing identifies MPL as a causative gene in familial aplastic anemia.
22102270 2011 Congenital amegakaryocytic thrombocytopenia: clinical presentation, diagnosis, and treatment.
22093990 2011 [STAT5 phosphorylation levels of erythropoietin and thrombopoietin receptors in CD34(+)CD59(-) and CD34(+)CD59(+) bone marrow cells of patients with paroxysmal nocturnal hemoglobinuria].
21892137 2011 Orientation-specific signalling by thrombopoietin receptor dimers.
21858098 2011 Effects of clinically relevant MPL mutations in the transmembrane domain revealed at the atomic level through computational modeling.
21841770 2012 Thrombopoietin receptor agonist therapy in primary immune thrombocytopenia is associated with bone marrow hypercellularity and mild reticulin fibrosis but not other stromal abnormalities.
21691276 2011 Primary myelofibrosis with or without mutant MPL: comparison of survival and clinical features involving 603 patients.
21674576 2011 Infrequent occurrence of MPL exon 10 mutations in polycythemia vera and post-polycythemia vera myelofibrosis.
21605620 2011 Humanized VB22B minibody for human Mpl stimulates human megakaryopoiesis but does not enhance platelet aggregation.
21570117 2011 Novel multiplex bead-based assay with LNA-modified probes for detection of MPL exon 10 mutations.
21555228 2011 Detection of MPL exon10 mutations in 103 Chinese patients with JAK2V617F-negative myeloproliferative neoplasms.
21489838 2011 A founder mutation in the MPL gene causes congenital amegakaryocytic thrombocytopenia (CAMT) in the Ashkenazi Jewish population.
21402716 2011 Thrombopoietin receptor activation: transmembrane helix dimerization, rotation, and allosteric modulation.
21326037 2011 MPL mutation profile in JAK2 mutation-negative patients with myeloproliferative disorders.
21228032 2011 Deep sequencing reveals double mutations in cis of MPL exon 10 in myeloproliferative neoplasms.
21225925 2011 CAMT in a female with developmental delay, facial malformations and central nervous system anomalies.
21174945 2010 PKC plays a crucial roles in c-mpl gene expression in megakaryoblastic cells.
21051030 2010 Prevalence of MPL W515L/K mutations in Taiwanese patients with Philadelphia-negative chronic myeloproliferative neoplasms.
20890078 2010 JAK2 V617F and MPL W515L/K mutations in Korean patients with essential thrombocythemia.
20823136 2010 Molecular mechanisms associated with leukemic transformation of MPL-mutant myeloproliferative neoplasms.
20529857 2010 Identification of the residues in the extracellular domain of thrombopoietin receptor involved in the binding of thrombopoietin and a nuclear distribution protein (human NUDC).
20520633 2010 Frequency and clinical correlates of JAK2 46/1 (GGCC) haplotype in primary myelofibrosis.
20508616 2010 IDH1 and IDH2 mutation studies in 1473 patients with chronic-, fibrotic- or blast-phase essential thrombocythemia, polycythemia vera or myelofibrosis.
20485371 2010 WHO-defined 'myelodysplastic syndrome with isolated del(5q)' in 88 consecutive patients: survival data, leukemic transformation rates and prevalence of JAK2, MPL and IDH mutations.
20410924 2010 IDH1 and IDH2 mutation analysis in chronic- and blast-phase myeloproliferative neoplasms.
20331763 2010 The analysis of JAK2 and MPL mutations and JAK2 single nucleotide polymorphisms in MPN patients by MassARRAY assay.
20304805 2010 The JAK2 46/1 haplotype predisposes to MPL-mutated myeloproliferative neoplasms.
20232601 2009 Rescue of multi-lineage hematopoiesis during HIV-1 infection by human c-mpl gene transfer and reconstitution of CD34+ progenitor cells in vivo.
20166549 2009 Modulation mechanism of c-Mpl promoter activity in megakaryoblastic cells.
20151976 2010 Clinical utility of routine MPL exon 10 analysis in the diagnosis of essential thrombocythaemia and primary myelofibrosis.
20113830 2010 Distinct patterns of cytogenetic and clinical progression in chronic myeloproliferative neoplasms with or without JAK2 or MPL mutations.
20113333 2010 Screening for MPL mutations in essential thrombocythemia and primary myelofibrosis: normal Mpl expression and absence of constitutive STAT3 and STAT5 activation in MPLW515L-positive platelets.
20111067 2010 MPL mutation effect on JAK2 46/1 haplotype frequency in JAK2V617F-negative myeloproliferative neoplasms.
19996410 2010 Induction of myeloproliferative disorder and myelofibrosis by thrombopoietin receptor W515 mutants is mediated by cytosolic tyrosine 112 of the receptor.
19880496 2010 Ubiquitination and degradation of the thrombopoietin receptor c-Mpl.
19728022 2009 Two rare MPL gene mutations in patients with essential thrombocythemia.
19713221 2010 Hereditary thrombocytosis caused by MPLSer505Asn is associated with a high thrombotic risk, splenomegaly and progression to bone marrow fibrosis.
19643476 2010 JAK2 and MPL gene mutations in V617F-negative myeloproliferative neoplasms.
19608689 2009 Evidence for a founder effect of the MPL-S505N mutation in eight Italian pedigrees with hereditary thrombocythemia.
19560457 2009 Interference RNA (RNAi)-based silencing of endogenous thrombopoietin receptor (Mpl) in Dami cells resulted in decreased hNUDC-mediated megakaryocyte proliferation and differentiation.
19521067 2009 Identification of MPL W515L/K mutations in patients with primary myelofibrosis and essential thrombocythaemia by allele-specific polymerase chain reaction.
19483125 2009 The Asn505 mutation of the c-MPL gene, which causes familial essential thrombocythemia, induces autonomous homodimerization of the c-Mpl protein due to strong amino acid polarity.
19469654 2009 Differential gene expression of bone marrow CD34+ cells in early and advanced myelodysplastic syndrome.
19372714 2009 Mutations in the JAK2 and MPL genes and their correlation to clinical parameters in patients with chronic myeloproliferative disease.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19341705 2009 CD90 and CD110 correlate with cancer stem cell potentials in human T-acute lymphoblastic leukemia cells.
19302922 2009 Compound heterozygous c-Mpl mutations in a child with congenital amegakaryocytic thrombocytopenia: functional characterization and a review of the literature.
19274616 2010 MPL W515L/K mutations in 343 Chinese adults with JAK2V617F mutation-negative chronic myeloproliferative disorders detected by a newly developed RQ-PCR based on TaqMan MGB probes.
19261614 2009 Ligand-independent thrombopoietin mutant receptor requires cell surface localization for endogenous activity.
19196872 2009 Biclonal expansion and heterogeneous lineage involvement in a case of chronic myeloproliferative disease with concurrent MPLW515L/JAK2V617F mutation.
19194467 2009 MPLW515L mutation in acute megakaryoblastic leukaemia.
19175989 2008 [Expression of JAK2V617F and MPLW515L/K mutation in 30 suspected cases of early myeloproliferative disorders].
19099657 2008 [MPLW515L point mutation in patients with myeloproliferative disease].
19097174 2009 Clinical significance of Gata-1, Gata-2, EKLF, and c-MPL expression in acute myeloid leukemia.
19036112 2009 Familial thrombocytosis caused by the novel germ-line mutation p.Pro106Leu in the MPL gene.
19029146 2009 Characterization of 35 new cases with four different MPLW515 mutations and essential thrombocytosis or primary myelofibrosis.
18754026 2008 JAK2 and MPL mutations in myeloproliferative neoplasms: discovery and science.
18687690 2008 AML1/RUNX1 works as a negative regulator of c-Mpl in hematopoietic stem cells.
18669880 2008 A sensitive detection method for MPLW515L or MPLW515K mutation in chronic myeloproliferative disorders with locked nucleic acid-modified probes and real-time polymerase chain reaction.
18566540 2008 JAK2 and MPL mutations in myeloproliferative neoplasms.
18528423 2008 New mutations of MPL in primitive myelofibrosis: only the MPL W515 mutations promote a G1/S-phase transition.
18519816 2008 Characteristics and clinical correlates of MPL 515W>L/K mutation in essential thrombocythemia.
18487512 2008 YRRL motifs in the cytoplasmic domain of the thrombopoietin receptor regulate receptor internalization and degradation.
18464114 2008 MPL W515L mutation in Chinese patients with myeloproliferative diseases.
18451306 2008 MPL mutations in myeloproliferative disorders: analysis of the PT-1 cohort.
18422784 2008 Functional analysis of single amino-acid mutations in the thrombopoietin-receptor Mpl underlying congenital amegakaryocytic thrombocytopenia.
18297515 2008 JAK and MPL mutations in myeloid malignancies.
18295514 2008 Promoter regulatory motifs involved in c-mpl gene expression induced by PMA.
18250227 2008 The impact of JAK2 and MPL mutations on diagnosis and prognosis of splanchnic vein thrombosis: a report on 241 cases.
18174381 2008 Expansion of multipotent and lymphoid-committed human progenitors through intracellular dimerization of Mpl.
18040685 2008 MPL 515 and JAK2 mutation analysis in MDS presenting with a platelet count of more than 500 x 10(9)/l.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17956691 2007 [Expressions of c-mpl proteins on CD34+ bone marrow cells and platelets of the patients with polycythemia vera].
17920755 2007 Phenotypic variations and new mutations in JAK2 V617F-negative polycythemia vera, erythrocytosis, and idiopathic myelofibrosis.
17920754 2007 The association of JAK2V617F mutation and leukocytosis with thrombotic events in essential thrombocythemia.
17709604 2007 Evidence for MPL W515L/K mutations in hematopoietic stem cells in primitive myelofibrosis.
17666371 2007 Congenital amegakaryocytic thrombocytopenia: clinical and biological consequences of five novel mutations.
17658515 2007 Regulation of cell differentiation by hNUDC via a Mpl-dependent mechanism in NIH 3T3 cells.
17644747 2007 Analysis of JAK3, JAK2, and C-MPL mutations in transient myeloproliferative disorder and myeloid leukemia of Down syndrome blasts in children with Down syndrome.
17540852 2007 Extending Jak2V617F and MplW515 mutation analysis to single hematopoietic colonies and B and T lymphocytes.
17507998 2007 Demonstration of MPLW515K, but not JAK2V617F, in in vitro expanded CD4+ T lymphocytes.
17408465 2007 Anaemia characterises patients with myelofibrosis harbouring Mpl mutation.
17408398 2007 Haematopoietic cell lineage distribution of MPLW515L/K mutations in patients with idiopathic myelofibrosis.
17379761 2007 Thrombopoietin enhances generation of CD34+ cells from human embryonic stem cells.
17157161 2006 Lineage-specific expression of granulocyte colony-stimulating factor and thrombopoietin receptors in terminally differentiated hematopoietic cells.
17107350 2006 Concurrent MPL515 and JAK2V617F mutations in myelofibrosis: chronology of clonal emergence and changes in mutant allele burden over time.
17052978 2006 The membrane-proximal region of the thrombopoietin receptor confers its high surface expression by JAK2-dependent and -independent mechanisms.
16868251 2006 MPL515 mutations in myeloproliferative and other myeloid disorders: a study of 1182 patients.
16834459 2006 MPLW515L is a novel somatic activating mutation in myelofibrosis with myeloid metaplasia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16470591 2006 MPL mutations in 23 patients suffering from congenital amegakaryocytic thrombocytopenia: the type of mutation predicts the course of the disease.
16454716 2006 Thrombocytopenia in HIV infection: impairment of platelet formation and loss correlates with increased c-Mpl and ligand thrombopoietin expression.
16088917 2005 A microtubule associated protein (hNUDC) binds to the extracellular domain of thrombopoietin receptor (Mpl).
15951300 2005 Thrombotic and bleeding complications in four subpopulations of patients with essential thrombocythemia defined by c-Mpl protein expression and PRV-1 mRNA levels.
15899890 2005 Janus kinases affect thrombopoietin receptor cell surface localization and stability.
15741216 2005 Low Mpl receptor expression in a pedigree with familial platelet disorder with predisposition to acute myelogenous leukemia and a novel AML1 mutation.
15647951 2005 Thrombocytosis in preterm infants: a possible involvement of thrombopoietin receptor gene expression.
15452260 2004 Targeting c-Mpl for revival of human immunodeficiency virus type 1-induced hematopoietic inhibition when CD34+ progenitor cells are re-engrafted into a fresh stromal microenvironment in vivo.
15307100 2004 Association of single nucleotide polymorphisms in the thrombopoietin-receptor gene, but not the thrombopoietin gene, with differences in platelet count.
15269348 2004 Mpl Baltimore: a thrombopoietin receptor polymorphism associated with thrombocytosis.
15210714 2004 A truncated isoform of c-Mpl with an essential C-terminal peptide targets the full-length receptor for degradation.
14995067 2003 Modulation of human c-mpl gene expression by thrombopoietin through protein kinase C.
14764528 2004 Familial essential thrombocythemia associated with a dominant-positive activating mutation of the c-MPL gene, which encodes for the receptor for thrombopoietin.
12200367 2002 The cytoplasmic domain of Mpl receptor transduces exclusive signals in embryonic and fetal hematopoietic cells.
12091373 2002 The expression pattern of c-mpl in megakaryocytes correlates with thrombotic risk in essential thrombocythemia.
11961237 2002 Human plasma thrombopoietin levels are regulated by binding to platelet thrombopoietin receptors in vivo.
11784712 2002 Cloning and characterization of a family of proteins associated with Mpl.
11133753 2001 c-mpl mutations are the cause of congenital amegakaryocytic thrombocytopenia.
11071383 2000 Compound heterozygosity for two different amino-acid substitution mutations in the thrombopoietin receptor (c-mpl gene) in congenital amegakaryocytic thrombocytopenia (CAMT).
11054408 2001 Thrombopoietin induces phosphoinositol 3-kinase activation through SHP2, Gab, and insulin receptor substrate proteins in BAF3 cells and primary murine megakaryocytes.
10979953 2000 Interferon-alpha directly represses megakaryopoiesis by inhibiting thrombopoietin-induced signaling through induction of SOCS-1.
10971406 2000 Mutations in the thrombopoietin receptor, Mpl, in children with congenital amegakaryocytic thrombocytopenia.
10918061 2000 A structure-function analysis of serine/threonine phosphorylation of the thrombopoietin receptor, c-Mpl.
10517496 1999 Thrombopoietin induces an SH2-containing protein, CIS1, which binds to Mpl: involvement of the ubiquitin proteosome pathway.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
10224114 1999 Thrombopoietin signal transduction requires functional JAK2, not TYK2.
10077649 1999 Identification of mutations in the c-mpl gene in congenital amegakaryocytic thrombocytopenia.
9766811 1998 Native thrombopoietin: structure and function.
9122198 1997 Dissecting the thrombopoietin receptor: functional elements of the Mpl cytoplasmic domain.
8639837 1996 Analysis of the thrombopoietin receptor (MPL) promoter implicates GATA and Ets proteins in the coregulation of megakaryocyte-specific genes.
8541543 1995 Megakaryocyte growth and development factor and interleukin-3 induce patterns of protein-tyrosine phosphorylation that correlate with dominant differentiation over proliferation of mpl-transfected 32D cells.
8202154 1994 Stimulation of megakaryocytopoiesis and thrombopoiesis by the c-Mpl ligand.
8020956 1994 Structure and transcription of the human c-mpl gene (MPL).
7534285 1995 The c-Mpl ligand (thrombopoietin) stimulates tyrosine phosphorylation of Jak2, Shc, and c-Mpl.
2550356 1989 The human homolog of the myeloproliferative virus maps to chromosome band 1p34.
2175677 1990 A putative truncated cytokine receptor gene transduced by the myeloproliferative leukemia virus immortalizes hematopoietic progenitors.
1608974 1992 Molecular cloning and characterization of MPL, the human homolog of the v-mpl oncogene: identification of a member of the hematopoietic growth factor receptor superfamily.